KEGG   Pantoea stewartii subsp. stewartii: DSJ_01090Help
Entry
DSJ_01090         CDS       T04970                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00564  Glycerophospholipid metabolism
pstw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pstw00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DSJ_01090
Enzymes [BR:pstw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DSJ_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N Lycopene_cycl GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ARF48114
UniProt: H3RHQ2
LinkDB All DBs
Position
201302..202807
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KSLTFGPDSALKPEIKRGFEYSDCWVDDARMVVLNAQEVVKHGGEVRTRTRVTRAWRENG
LWMVEAEDIDSGKTLTWQAKGLVNAAGPWVKQFFDDGLALKSPYGIRLIKGSHIVVPRVH
NEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVAIDDNEIDYILKVYNSHF
KKQLTPDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDENGKTPLLSVFGGKLTTYRK
LAEHAMEKLAKYYPKAGPAWTKNCVLPGGNISGTSDDYAASLRRRYPFITENMARHYSRT
YGSNTELLLNDATSLEDLGENFGHEFYEAELRYLVQHEWVREVDDAIWRRTKQGMWLNEA
QQARIAEWLAEKAKPTLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgttatcggcggcggcatcaacggtgctggcatcgcagca
gacgctgcaggacgcggactgtcggtgttaatgctagaggcgcgggacctggcttgcgcg
acctcttccgccagttcaaaactgattcatggtggcctgcgctaccttgaacattatgag
tttcgtctggtaagtgaagcgctggctgagcgcgaagtgctgctaaaaatggcaccgcat
atcgcgttcccgatgcgtttccgcctgccgcaccgtccgcatctgcgcccggcctggatg
attcgcaccggtctgttcatgtatgaccacctgggcaaacgcaccagcctgccgggcagt
aaaagcctgacctttgggccggattcggcgctgaagcctgaaattaaacgtggtttcgag
tattccgactgctgggtcgatgatgcccgtatggtcgtcctcaatgcgcaggaagtggtt
aagcatggcggtgaagtgcgcacccgtacccgcgttacccgcgcgtggcgtgaaaatggc
ctgtggatggtcgaagcagaagacattgacagcggcaaaaccttaacctggcaggctaaa
ggtctggtcaacgcagccggcccctgggttaagcaattctttgacgacgggctggcgctg
aagtcgccttacggtatccgcctgattaaaggcagccatatcgtggtgccacgcgttcac
aacgagaagcaggcttatatcctgcaaaacgaagataaccgcattgtgtttgtcattccg
tggatggacgagttttccatcatcggcacaaccgacgtggaatacaaaggcgatccgaaa
aatgtcgctattgacgacaacgaaatcgactacatcctgaaagtgtacaacagccacttt
aaaaagcagttaacgcctgacgatatcgtctggacctattccggcgtgcgcccgctgtgt
gatgatgaatcggattctccgcaggccatcacccgtgactacacgctggacgttcgtgat
gaaaacggtaaaacgccattactgtcggtctttggcggtaaattaacgacctatcgcaag
ctggctgagcatgcgatggagaaactggcgaagtattatcccaaggctggcccggcctgg
acgaagaactgcgtattgcccggcggtaatatctctggcaccagtgatgactacgctgcc
agcctgcgccgccgttatccgtttattactgaaaacatggcgcgccactattcccgcact
tacggcagcaacacggaactgctgctcaacgatgcaacgtcgctggaagatctgggtgag
aactttggccacgagttttatgaggccgaactgcgttaccttgttcagcatgaatgggtg
cgtgaagtcgacgacgctatctggcgccgcaccaagcaaggtatgtggctcaacgaagcc
cagcaggcccgtatcgctgagtggctggcggagaaggccaagccgacgctgtcgctggcc
tcgtaa

DBGET integrated database retrieval system