KEGG   Pantoea stewartii subsp. stewartii: DSJ_06550Help
Entry
DSJ_06550         CDS       T04970                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DSJ_06550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pstw01003]
    DSJ_06550
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pstw01011]
    DSJ_06550
Enzymes [BR:pstw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     DSJ_06550
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DSJ_06550
Glycosyltransferases [BR:pstw01003]
 Polysaccharide
  Bacterial polysaccharide
   DSJ_06550
Peptidoglycan biosynthesis and degradation proteins [BR:pstw01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   DSJ_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484 TFIIA
Motif
Other DBs
NCBI-ProteinID: ARF49032
UniProt: H3R8Q1
LinkDB All DBs
Position
1357780..1360317
Genome map
AA seq 845 aa AA seqDB search
MSGNDREPIGRKGKPLPPRNSARRGRRRDIDSDVAQDDFDDDYEEEAPVPRKGKGKGGKP
PRGKRRWLGWFIKLFLVFVVVMAAWGVYLDSEIRSRIDGKVWQLPAAVYGRMVSLEPGMA
YNKSEMIALLEGTQYREVSRITRPGEFSVKGNTIELLRRPFDFPDSKEGQIHARMTFSKD
ELSEIKNVETGRDFGFFRLDPRLITMLQSPNGEQRLFVPRAGFPDLLVDTLIATEDRHFY
EHDGISPYSIGRAFLANITAGKAVQGGSTLTQQLVKNLFLTNERSLWRKAREAYMAVIMD
ARYSKDRILELYLNEVYLGQAGNDQIRGFPLASLYYFGRPVDELSLDQQAMLVGMVKGAS
LYNPWRNPKLALERRNLVLRLLQQQKVIDQELYDMLSARPLGVQPKGGVITPQPAFMQMV
RNELQAKLGDKVKDLSGVKIFTTLDPVSQDAAEKAVVDGIPTLKKQRGLKDLETAMVVVD
RFTGEVRAMVGGADPQFAGYNRALQARRSIGSLAKPATYLTALSQPNTYRLNSWIADEPI
ALKQPNGSIWKPMNDDRRFSGKVMLVDALTNSMNVPTVNLGMTLGLNAVVDTWTKLGVPK
DQLNPVPAMLLGALNLTPVEVAQAFQSIASGGNHAELSAVRSVIAEDGTVLYQSFPQAQR
VEPAQAAYLTLYTMQQVVDRGTARALGARFPNAHLAGKTGTTNDLVDSWFAGIDGKEVAI
TWVGRDNNQPTKLYGASGAMQIYRRYLDNQAPMPLQLTPPEDVTMMNIDTAGNFVCGTGS
STWRTLPVWTLDPNALCQQQQQQVQQMQQQQQMQDQQQQQLQQQQQQEQKDSNGVAGWIK
DMFGK
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaacgatcgcgaacctattgggcgcaaaggaaaaccgttgccaccgcgcaac
agcgcccgccgtgggcggcgcagagacatcgatagtgatgtcgctcaggacgattttgat
gatgattacgaggaggaagcgccggtgccacgtaaaggtaaaggtaaaggtggaaaaccg
ccgcgcggcaaacgccgttggctgggatggtttattaagctgttcctggtatttgtagtg
gtcatggccgcgtggggcgtatacctcgattcggaaattcgcagccgcattgacggtaaa
gtgtggcaactgcccgctgctgtctacggtcgtatggtcagcctcgaacctggcatggcc
tacaataaaagcgaaatgattgccctgctggaaggcacgcagtaccgcgaagtctcgcgc
attacgcgtccgggagaattctcggtcaaaggtaacaccattgaactgctgcgtcgtccg
tttgatttcccggacagcaaagaagggcagattcatgcccgaatgacattcagcaaagat
gagctgagtgagattaagaacgtcgaaaccgggcgtgattttggtttcttccggcttgat
cctcgtctgattacgatgctgcagtcacccaatggtgaacagcgcttgttcgttccccgt
gccggtttccctgatctgttggtggataccttaatcgcaacggaagatcgccacttttat
gagcacgacggcatcagcccgtactccattggccgtgccttcctggcgaacatcaccgcc
ggaaaagcggtgcagggcggcagtacgcttacccagcaactggtcaaaaacctgttcctg
actaatgagcgttcgctgtggcgtaaagcccgtgaagcctatatggccgtgatcatggat
gcccgttacagcaaagatcgtatcctggagctttacctgaacgaggtgtatctcggtcag
gcaggtaacgatcagatccgcggtttccctctggccagcctctactattttggccgcccg
gttgacgagctgagtctcgatcagcaggcgatgctggtgggcatggtgaaaggggcgtcg
ctctataacccatggcgtaacccgaaactggccctggaacgacgtaatctggtgctgcgc
ctgctgcagcagcagaaagtgatcgatcaggaactgtacgacatgctgtcggcccgtccg
ttgggcgtgcagccgaaaggcggtgtgattacgccacagcctgcctttatgcagatggtg
cgtaatgagcttcaggcaaaactgggcgacaaagtcaaagatctgtcgggcgtgaaaatt
ttcaccaccctggatccggtttctcaggatgcggccgaaaaagccgttgtagacggtatt
cccaccctgaaaaaacagcgcggtctgaaagatctggaaaccgcaatggtggtcgttgac
cgctttacaggtgaagttcgtgcgatggtcggtggggccgatccgcagtttgccgggtat
aaccgcgcgttgcaggcgcgccgatccatcggctcgctggcgaaaccggccacctatctg
accgcgctgagccaacccaacacttaccgcctgaacagctggattgcggatgagcctatt
gcgctgaaacagccgaatggcagcatctggaaacccatgaacgacgaccggcgctttagt
ggcaaagtgatgctggtcgatgcgctgacgaactccatgaacgtgccaacggttaacctg
ggcatgacgctgggactgaatgcggtggtggacacctggacgaagctgggtgtgcctaaa
gatcagctgaatccggttccggcgatgttactgggcgcactcaacctgacgcctgtggaa
gtggctcaggccttccagtccattgccagcggcgggaatcatgcagagctgtcagccgtg
cgttcggtcatcgcggaagacggtaccgtgctgtatcagagcttcccgcaggcgcagcgc
gttgaaccggcacaggcggcttatttaacgctgtataccatgcaacaggtcgtcgatcgc
ggtaccgcccgggcgctgggggcacgtttcccgaatgcgcacctggcagggaaaaccggc
accacgaacgatctggtcgacagctggtttgccgggattgatggtaaagaagtggcgatc
acctgggttggccgtgataacaaccagccgaccaaactctatggtgccagcggggcgatg
cagatttaccgccgctacctggacaatcaggctccgatgccgctgcagcttacgccgccg
gaagatgtgacgatgatgaacatcgatactgcgggtaactttgtttgcggtacaggaagc
agcacatggcgcacgctgcctgtctggacactggatccgaatgcgctctgccagcagcag
caacagcaggttcagcaaatgcagcaacagcagcagatgcaggaccagcaacagcagcag
ttacagcagcagcaacagcaggaacaaaaagacagcaacggcgttgccggctggataaaa
gatatgttcggtaaataa

DBGET integrated database retrieval system