KEGG   Pantoea stewartii subsp. stewartii: DSJ_07920Help
Entry
DSJ_07920         CDS       T04970                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
pstw  Pantoea stewartii subsp. stewartii
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pstw01002]
    DSJ_07920
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pstw01011]
    DSJ_07920
Enzymes [BR:pstw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DSJ_07920
   3.4.21  Serine endopeptidases
    3.4.21.-  
     DSJ_07920
Peptidases [BR:pstw01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   DSJ_07920
Peptidoglycan biosynthesis and degradation proteins [BR:pstw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DSJ_07920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ARF49274
UniProt: H3RAP1
LinkDB All DBs
Position
complement(1642867..1644036)
Genome map
AA seq 389 aa AA seqDB search
MKMRTPYLLALLVSLLPLKSTAQVAPDPLLASQIVDRYAEHIFYASGATGMALVAIDGNQ
RVFTSFGDTRPGNNIRPQKDSLIRIASLSKLMTSEVMVKMAERGEIRLDDPLSKYAPPGK
RVPGFDGQPIRLINLATHTSGLPREQPGGKPHRPVFVWPTQSERWNWLNTASLKAAPGTN
AAYSNLGYDLLGDALSRAAGKPYPALFQQLITRPLGMKDTTFTPSPEQCARLMVAEKGAS
PCNNTLAAIGSGGVYSTPDDMGRWMQQFLNSSVNRRTPQIDRLQTLIYRRDQLHKVDGMD
VPGKADALGMGWVYMGPSKGRPGIIQKTGGGGGFITYIAMVPQNNVGVFVVVTRSPLTRF
TPMSDGVNNLLAELVGNQTGSPMMVQAIP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgcgcactccttatttactggctttactggtttctttgcttccccttaaaagc
acggcgcaggttgcgcccgatcccttactggcctcccagattgtcgatcgctatgcagag
catatcttttatgccagtggtgccaccggcatggccctggtggcaatagacggtaatcag
cgcgtctttaccagctttggtgatacccggcccggcaacaatattcgtccgcaaaaggat
tcgttaattcgtattgcctcgctcagtaaattaatgaccagtgaggtgatggtaaaaatg
gccgagcgcggcgagattcgtctggacgatccgctgagtaagtatgcgcctccgggaaaa
cgggtccctggtttcgacggtcaaccgattcggttgattaacctcgccactcacaccagt
ggcctgccgcgcgagcagcccggcggtaagccgcatcgtccggtttttgtctggcctacg
caaagtgagcgctggaactggctgaacaccgccagcctgaaagcggcccccggcaccaat
gcggcctattccaacctgggttacgatctgttgggtgatgcgctgtcacgtgcggcgggt
aaaccctatccggccctgtttcagcagctgatcacccgtccgctgggcatgaaggacacc
acgtttaccccgtcacccgaacagtgcgcccgtttaatggtggcggaaaaaggagccagt
ccgtgtaataacacgctggcggctatcggcagcggtggcgtctattcaacgccggatgat
atgggacgctggatgcagcagtttctgaactcctccgtaaatcgccgcacgccacagatc
gatcgcctgcagacattaatctaccgtcgcgatcagcttcacaaggtggatggaatggac
gtgccaggtaaagccgacgctctcggcatgggttgggtttatatgggaccgtcaaagggg
cgtccgggcatcattcagaaaaccggcggtggcgggggtttcatcacctatatagcgatg
gtgccgcagaataatgtgggcgtttttgtggtggtgacccgatctcccctgacccgcttc
acgccaatgagtgacggtgtaaataacctgctggcggagttggtgggcaatcagaccggt
tcccccatgatggtgcaggcgattccttaa

DBGET integrated database retrieval system