KEGG   Pantoea stewartii subsp. stewartii: DSJ_13100Help
Entry
DSJ_13100         CDS       T04970                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pstw  Pantoea stewartii subsp. stewartii
Brite
Enzymes [BR:pstw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DSJ_13100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ARF50184
UniProt: H3RCD8
LinkDB All DBs
Position
2618795..2619313
Genome map
AA seq 172 aa AA seqDB search
MKVNAIAIATLLACGAAQAASEQVTIHAVSVQGIGNAIGTVNIEETQYGLQLTPMLEGLK
PGIHGFHVHAKGSCEPGESEGKRVAAGAAGGHLDPANTGKHLGPYAEGHLGDLPALYVDA
QGKATYPVLAPRIKTLSEVKGKALMVHVGGDNHADHPQPLGGGGARFACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaacgcaattgcgatagcgacgctgttagcctgcggtgccgcgcaggcggcc
agcgaacaggtgacaattcatgccgtttcggtgcagggaatcggcaatgccatcggcacg
gtaaatattgaagagacgcaatacggtttgcaactgacgcccatgctggaaggactgaag
ccgggcattcacggttttcatgtccatgcgaaaggcagctgtgaacccggcgaatcggaa
ggaaaaagggtggccgcgggggcggcaggggggcatcttgatccggcgaacaccggcaag
cacctggggccctatgctgagggccatttaggcgacctgcctgcgctctatgtcgatgcg
cagggtaaagccacctatccggtgctggcaccgcgcattaaaacgctgagcgaggtgaaa
ggcaaagcgttgatggtgcatgtgggcggggataaccatgcggatcacccacaacctttg
ggcggtggcggggcacggtttgcctgcggtgttatctga

DBGET integrated database retrieval system