KEGG   Pantoea stewartii subsp. stewartii: DSJ_17300Help
Entry
DSJ_17300         CDS       T04970                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00061  Fatty acid biosynthesis
pstw00780  Biotin metabolism
pstw01100  Metabolic pathways
pstw01212  Fatty acid metabolism
Module
pstw_M00083  Fatty acid biosynthesis, elongation
pstw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DSJ_17300
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DSJ_17300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pstw01004]
    DSJ_17300
Enzymes [BR:pstw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     DSJ_17300
Lipid biosynthesis proteins [BR:pstw01004]
 Fatty acid synthase
  Component type
   DSJ_17300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ARF50915
UniProt: H3RF33
LinkDB All DBs
Position
complement(3531931..3533151)
Genome map
AA seq 406 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQEMKYSGMRSHVWGNVKLDTTGLI
DRKIVRFMSDASIYAYLSMEEAIKDSGLSNEAYQNNPRVGLIAGSGGGSPRFQVFGADAM
RSPRGLKAVGPYVVTKAMASGVSASLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG
KQDIVFAGGGEELCWEMACEFDAMGALSTRYNDTPEKASRTYDNERDGFVIAGGGGMVVV
EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMQGVDTPIDYLNSHGT
STPVGDVKELGAIREVFGENTPYISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
ISSLDAAAEGMNIVTEPTEKALTTVMSNSFGFGGTNATLTLRKYQA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgctgtgattactggcttagggatcgtttccagtattggtaataaccagcaa
gaggtgctggcatctctgcgtgaaggccgctcaggcatcactttttcccaggagatgaaa
tattccggcatgcgtagtcacgtctggggtaacgttaaactcgataccaccggcctcatt
gatcgcaaaattgtgcggttcatgagtgatgcgtccatctatgcttacctgtcaatggaa
gaagctatcaaagattctggcctgagcaacgaagcctaccagaacaaccctcgcgtaggt
ttgattgcaggttccggcggcggttctccacgttttcaggtttttggcgcggatgcgatg
cgcagcccacgcggcctgaaagccgttggcccttatgtggtgaccaaggcgatggcatcc
ggtgtttctgccagcctggccacaccgtttaaaatccacggcgtaaactactctatcagt
tcagcctgtgcgacctctgcacactgtattggtaacgcggttgagcagattcaactgggc
aagcaggatatcgtttttgccggcggcggcgaagagctgtgctgggaaatggcctgtgag
ttcgatgcgatgggcgccctgtcgacccgttacaacgacacgccagaaaaagcgtcacgt
acctatgacaacgagcgcgacggcttcgttatcgcaggcggcggcggtatggtcgtggtg
gaagagctggagcatgcgctggctcgtggcgcgcacatctatgctgaaatcgtgggctac
ggtgccacctctgatggtgctgatatggtcgcaccgtcaggtgaaggcgctgtacgctgc
atgaagatggcgatgcagggcgtggacacgccaatcgactatctgaacagccatggtacc
tctacgccagtgggcgatgtcaaagagctgggtgctattcgtgaagtgtttggcgaaaac
acaccgtacatctctgcgaccaaagccatgaccggccactccttaggagcggcgggtgtg
caggaagcgatttactcactgctgatgctggagcacggctttatcgccccaagcattaac
atcagctcgctggacgccgcggcagaaggcatgaacatcgtgacagagccgacggaaaaa
gcccttaccaccgtgatgtctaacagctttggtttcggcggcaccaacgccaccctgacc
ctgcgtaaataccaggcataa

DBGET integrated database retrieval system