KEGG   Pantoea stewartii subsp. stewartii: DSJ_20810Help
Entry
DSJ_20810         CDS       T04970                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00550  Peptidoglycan biosynthesis
pstw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DSJ_20810
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DSJ_20810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pstw01011]
    DSJ_20810
Enzymes [BR:pstw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DSJ_20810
Peptidoglycan biosynthesis and degradation proteins [BR:pstw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   DSJ_20810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ARF51510
UniProt: H3RA58
LinkDB All DBs
Position
4173457..4175340
Genome map
AA seq 627 aa AA seqDB search
MNFRDFDAEEKLFVRRAAMAFVLVCLCFSILGFNLYRLQVRDHSYYQTRSNENDIKMIPI
APTRGLIFVRNGIPLVRNVTWYDITVTPYKVEDMKALLQELTPLVDLTPEDIERFQHDLH
QTSRYKPVILKEELTDEEVARFSVNQFRFTGVSIDTYQDREYPYGADLAHVIGYVSKIND
NDYKRLNAEGIAENYAADHNIGKQGIEGYYESLLHGKPGYQEVEVDNHGRIVRVLKEVPP
VAGKNITLTLDLHLQQYAESLLVGQRAALLVEDPHDGSVLAMVSSPSYDPNPFVKGISYQ
AYKKLLQDKNLPLINRVTQGLYPPASTVKPYMAMSALLTHVITPQTTFFGGPTWTLPGTD
RRYRDWKKSGHGTLDVTKAIEESADTFFYQVAFMMGIDRIHTMLSKFGYGQSTGIDLNEE
YNGLLPSRDWKMKVHKKPWYQGDTVSVGIGQGYWIATPIQMVKALVALINNGRVIAPHLL
EKSQLGNHVQLYQPKLPQAQIGDPHSPYWSLVRHAMFGMANAPNGTGYKYFHTAPYGIAA
KSGTSQVFSLKQNQTYNAKMIPVRLRDHTFYTAFAPFNDPKVAVALILENGGSEGVLAAP
VMRQLLDHIFLPPTTPPPVEVAQRPAR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccgtgatttcgacgctgaagagaagttgtttgtccgccgtgccgctatggcg
tttgtactggtttgcctgtgctttagcatcctgggttttaacctgtatcgcctgcaggtc
cgcgaccacagctattatcagacgcgctcgaacgagaatgacatcaaaatgatccccatt
gcgcccacgcgcggactgatctttgtccgcaacgggatcccgctggtgcgcaacgtgacc
tggtatgacatcacggttaccccgtacaaagtggaggacatgaaggcgctgttgcaagaa
ctgacgccactggttgatctgaccccggaagatattgagcgctttcagcacgatctgcat
cagaccagccgctataagcccgtcattctcaaagaggaactcacagacgaagaggtggcg
cgtttttcggttaaccagttccgttttaccggcgtcagcattgatacctatcaggaccgg
gaatatccctatggggccgatctcgcgcatgtgatcggctatgtttccaaaatcaacgat
aacgactacaagcggctgaacgcagagggcatcgctgaaaactatgctgccgaccataac
atcggtaagcaggggattgagggctattacgaatccctgctgcacggcaaacccggctat
caggaagtggaagtggataaccacgggcgcattgtccgggtgctgaaagaagtgccgccg
gtggcgggaaagaacattacgctgacgctggatctgcatctgcaacagtacgcggaaagc
ctgctggtcgggcagcgcgccgcgttgctggtcgaagatccccatgacggctcagtgctg
gcgatggtttccagccccagctacgatcccaatccgttcgtaaagggcatcagctatcag
gcgtacaaaaagctgctgcaggataaaaatttaccgctgatcaaccgtgtcacgcagggc
ctgtatccgccggcctcaacggtaaaaccctatatggcgatgtcggcgctgctcacgcac
gtcattacgccacagaccaccttttttggcgggcccacctggacattacccggtactgac
cgccgctatcgcgactggaaaaaaagcggtcacggtacgctggatgtcactaaagcgatc
gaagagtcggcggataccttcttctatcaggtggcgtttatgatgggcatcgatcgtatt
cacaccatgctcagtaaatttggctacggtcagtccaccggcatcgatctgaatgaagag
tacaacggactgctgcccagccgtgactggaagatgaaagtgcataagaaaccctggtat
cagggcgatacggtgtcagtcggcattggtcagggctactggattgccacgccgattcag
atggtaaaggcgctggtggcgctgattaacaatggcagagtcattgccccgcacctgctg
gagaaatcgcagcttggcaaccacgtgcagctttaccagccgaaactgccgcaggcgcag
attggtgatccgcattccccttactggtcgctggtgcgtcacgcgatgtttggcatggct
aacgcgccgaatggcacaggctacaagtatttccacaccgcgccttatggcattgctgcc
aagagtggaacgtcgcaggtattcagcctgaaacaaaatcagacctacaatgccaaaatg
atcccggtgcggctgcgcgatcatacgttttataccgccttcgccccctttaacgatcct
aaggtggctgtggcgttgatcctggaaaatgggggcagcgaaggcgtgctggccgcgccg
gtaatgcggcagcttctcgatcatattttcctgccgcccaccacgccgccgcccgttgag
gttgcccagcgtccggcccgctag

DBGET integrated database retrieval system