KEGG   Pedobacter steynii: BFS30_05445Help
Entry
BFS30_05445       CDS       T04469                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psty  Pedobacter steynii
Pathway
psty00620  Pyruvate metabolism
psty00680  Methane metabolism
psty01100  Metabolic pathways
psty01120  Microbial metabolism in diverse environments
psty01200  Carbon metabolism
Module
psty_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psty00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFS30_05445
  Energy metabolism
   00680 Methane metabolism
    BFS30_05445
Enzymes [BR:psty01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BFS30_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOM76650
UniProt: A0A1D7QDB6
LinkDB All DBs
Position
complement(1353744..1356332)
Genome map
AA seq 862 aa AA seqDB search
MMQKQRAKGQRESVFNNEVISRFELYNSLFLTLPFYKVKDTGTLLPLFIKYCEDGVKNHE
TPAGIINAFFEKYTQNNSKKDIIDLLFRFIQYIERQVVLFDAVEDASFNKLNADEEHSAL
LVYLKKGVDNKPLNEKIEKLIDEFSLRLVLTAHPTQFYPGSVLSIITDLTSAIKTNDIST
INQLLQQLGKTPFFNKKSPTPVDEALSLAWYLENVFYFAAANIQSEIDQSLNDYNLESKK
IIELGFWPGGDRDGNPNVHTDSTIQVSKMLRQILFRCYYRDFRNLKRRITFRGVEDNIAL
VHDVLYKNAFDPNIETENISDFLIENLNKIKTTLIEDHDGLFSDLVSDLIRKVELYGSHF
ASLDIRQDSRVLRDVHAYCRNNKPINALYPENYDSLNEEEKIKALVFKSAKINYTEQPDS
LTQDTLETIAEIKQIQQSNGEMACHRFIISNCQQASDILQLMELFLWNGWTEDELSIDFV
PLFETVHDLAGAAEIMETLYSHSFYKKHLANRGGKQHIMLGFSDSTKDGGYLMANWSIFN
AKVALTATADQHQIQLAFFDGRGGPPSRGGGKTHRFYASMGKEIANKNIQLTIQGQTISS
QYGSIDSAEFNMEQMINAGISAGMKEKHNILLDPLHKNLLDEMATESYDSYVSLRKHPLF
LSYLEKFSPLTLLSKITISSRPVKRNSGGSLKLEDLRAIGFVTAWSQLKQNIPGFYGIGT
ALKNQEKQGNWDKVVKTYQESGYFKTIIDNCMMSMSKADFSITAHFANDKEYGAFWKMLY
EEFELSKTLLLKLSGHETLMENYPVEKRSISVREKIVLPLVLIQHYALEQLQNEVTDEEQ
QSLEKLSIRTVYGIVNAGRNLA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaaacaacgcgcaaaaggtcagagagaatctgtttttaacaatgaagttata
tccagatttgaactttataacagccttttccttacccttcccttctacaaagtaaaagac
accggaactttacttccgctattcattaagtattgtgaagatggtgtcaagaaccacgaa
acaccagcaggaatcattaacgcattttttgaaaagtatactcaaaataattccaaaaag
gacattatagatttacttttccgcttcattcaatatattgaacgtcaggtcgtattgttt
gatgccgttgaagatgcctccttcaataaactaaatgcagatgaagaacacagtgcttta
ttggtttatctgaaaaagggggtcgataacaagcctttaaacgaaaaaatagaaaagctg
atcgatgagttttcactccgcctggtccttacggcccacccaacccagttttatcctgga
agcgtcttgtctatcatcaccgatttaacttctgcaataaaaaccaatgatatttcgacc
attaaccaactgttgcagcaattggggaaaacgccttttttcaataaaaaatcaccaaca
cctgttgatgaagcattaagcctggcctggtatcttgaaaacgtcttttatttcgcagca
gcaaacattcaatcggaaatcgatcaaagcctgaatgactataacctggaatctaaaaag
atcatagaacttggcttctggccaggaggagatcgtgacggcaatccaaatgtccatacc
gattctaccattcaggtatccaaaatgctccgtcagattctattcaggtgctattacaga
gatttcaggaacctaaagcgccgcattactttcagaggtgtagaagataatattgccctt
gtacatgatgtgctctacaaaaacgcgtttgatcccaatatagaaaccgagaacatttcc
gattttttaattgaaaatctgaataaaataaaaactaccctaatagaagaccacgacggg
ctattctccgatctcgtttccgacctgattcgtaaggtagaactttatgggagtcacttt
gcctctttggatatcagacaggacagcagagtgcttagggatgttcacgcgtactgccgc
aacaacaaacccatcaacgccttatatcctgagaattatgacagcctgaatgaagaagag
aaaatcaaggcgctggtatttaaaagtgccaagataaactatacagaacaacccgactcg
ttaacacaggacaccttggaaaccattgctgaaatcaaacaaattcagcaaagcaacgga
gaaatggcttgccataggtttattatcagtaattgccagcaggcaagcgatattttacag
ctaatggaactgtttctttggaacggatggacagaagatgagttaagtatagactttgtc
cctctttttgaaacagtgcatgatctcgccggtgctgcggaaattatggaaactctatat
agccattctttctataaaaaacatcttgccaacaggggcggcaagcaacacatcatgctt
ggcttctctgacagtaccaaagatggtggttatttaatggccaactggtcgatttttaat
gcaaaagtagcgttaaccgccactgcagatcagcaccagatacaactcgccttttttgat
ggcagaggaggccccccatcccgtggaggaggtaaaacccatcgtttctatgcctctatg
ggtaaagaaattgccaacaagaatattcaactgaccatccagggtcaaaccatcagttct
cagtacggttctatcgacagtgcagaattcaatatggagcaaatgatcaatgccggaatt
tccgctggaatgaaggaaaagcacaatatccttttagacccattacataaaaacttgctg
gatgaaatggccacagaaagctatgattcttatgtttcactgcgtaaacatcctttgttt
ctaagctatctggagaaattctctcctttaaccctgctttctaaaattaccatcagcagc
agaccggtaaaaaggaactcgggaggatctttaaaactggaagacctcagagcaattggc
ttcgtaaccgcatggagtcaactaaaacagaatattccaggcttttatggtattggtacc
gcattgaaaaatcaggaaaaacagggtaattgggataaagtcgttaagacttatcaggaa
tccggatactttaaaaccattatcgacaactgcatgatgtctatgagcaaagccgatttc
tccattactgctcattttgccaatgataaagagtacggggctttctggaagatgctttat
gaggaatttgagctatctaaaaccctcttattaaaactatccggacatgagaccttaatg
gagaattacccggttgagaagcgctctatttccgttagggagaagatcgtacttccatta
gtcctgatccagcattatgccttggaacagttgcaaaatgaagttacagatgaggaacaa
caatctctggaaaaactatccatcagaacggtctatggtatcgtaaatgcgggtaggaat
ctcgcttaa

DBGET integrated database retrieval system