KEGG   Pedobacter steynii: BFS30_05675Help
Entry
BFS30_05675       CDS       T04469                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psty  Pedobacter steynii
Brite
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BFS30_05675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOM76693
UniProt: A0A1D7QDB0
LinkDB All DBs
Position
1402633..1403238
Genome map
AA seq 201 aa AA seqDB search
MAFELPALPYATDALEPHIDKLTMEIHHGKHHQAYVTNLNKALEGKAEASQSIEEIVKNI
SKFPAAVRNNGGGHYNHSLFWEVLAPNKGGEPKGELAEAINAAFGSFADFKTKFAEAGAT
RFGSGWAWLIVTADNKLAVTSTPNQDNPLMDIAEVKGTPVLGMDVWEHAYYLKYQNRRPD
YISAFWNVVNWDAVAERFKKA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattacctgcgttaccttacgcaacagatgcactagaaccgcatattgat
aaacttacaatggaaatccaccatggtaagcatcaccaggcatacgttaccaacttaaat
aaagctttagaaggtaaagcggaagctagccaaagcatcgaagaaattgttaaaaacatc
tctaagtttcctgctgcagtaagaaacaatggtggtggtcactataatcactctttattc
tgggaagttcttgctccaaacaaaggtggtgagcctaaaggagaattagcagaagcaatc
aatgctgctttcggttcttttgcagattttaaaactaaatttgctgaagctggtgcaacc
cgtttcggttcaggatgggcttggttaatcgttactgctgacaataaattagcggtgact
tctacaccaaatcaagacaatcctttaatggatattgctgaagttaaaggtactcctgta
ttgggtatggatgtatgggaacatgcttactacttaaaatatcaaaacagacgccctgat
tatatttcggctttctggaatgtagtaaactgggatgctgttgcagaacgcttcaaaaaa
gcataa

DBGET integrated database retrieval system