KEGG   Pedobacter steynii: BFS30_06065Help
Entry
BFS30_06065       CDS       T04469                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psty  Pedobacter steynii
Pathway
psty00010  Glycolysis / Gluconeogenesis
psty00053  Ascorbate and aldarate metabolism
psty00071  Fatty acid degradation
psty00280  Valine, leucine and isoleucine degradation
psty00310  Lysine degradation
psty00330  Arginine and proline metabolism
psty00340  Histidine metabolism
psty00380  Tryptophan metabolism
psty00410  beta-Alanine metabolism
psty00561  Glycerolipid metabolism
psty00620  Pyruvate metabolism
psty00625  Chloroalkane and chloroalkene degradation
psty01100  Metabolic pathways
psty01110  Biosynthesis of secondary metabolites
psty01120  Microbial metabolism in diverse environments
psty01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFS30_06065
   00053 Ascorbate and aldarate metabolism
    BFS30_06065
   00620 Pyruvate metabolism
    BFS30_06065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFS30_06065
   00561 Glycerolipid metabolism
    BFS30_06065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFS30_06065
   00310 Lysine degradation
    BFS30_06065
   00330 Arginine and proline metabolism
    BFS30_06065
   00340 Histidine metabolism
    BFS30_06065
   00380 Tryptophan metabolism
    BFS30_06065
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFS30_06065
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BFS30_06065
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BFS30_06065
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BFS30_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AOM76766
UniProt: A0A1D7QDJ4
LinkDB All DBs
Position
complement(1491911..1493449)
Genome map
AA seq 512 aa AA seqDB search
MKTNISSVLKNLGIQELNPAYSTGNHWAASSNAKTIDSYSPVDGKKIASVQVATADDYET
VMKKAEEAFVFWRGLPAPKRGEIVRQFGDALRESKEDLGTLVSYEMGKSLQEGFGEVQEM
IDICDFAVGLSRQLYGLTMHSERPNHRMYEQWHPMGIVGIISAFNFPVAVWSWNTALAWV
CGNVCVWKPSSKTPLCAVACQHIIAKVLKANDMPEGISSLLIGNAVGDMMNNDKRIPLVS
FTGSTRIGRMVSTAVAGRFGRSILELGGNNAIIISKDADIEMSIIGAVFGAVGTAGQRCT
STRRLIIHEDIYEDFKNRLVKAYGQLRIGDPLDQHNHVGPLIDVYAADMYTDAIEKGKKE
GARFVVEGGILSGDQYSSGCYVKPCVAEVENHYEIVQEETFAPILYLIKYKTLEEAIALQ
NGVPQGLSSAIMTLNLREAEQFLSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRES
GSDAWKAYMRRQTNTINYANTLPLAQGIKFDL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaacatcagttccgttttaaaaaacttagggattcaggaattaaatcctgcg
tacagcacaggtaatcactgggctgcttcatcaaatgcaaaaactatagacagctattct
ccggttgacggaaaaaaaatcgcaagtgtacaggtcgctactgcagatgactatgagacc
gtaatgaaaaaagcggaagaagcatttgttttctggcgcggcttaccggcacctaaacgt
ggagagattgtacgtcagtttggagatgctttaagagaaagcaaagaagatctgggtact
ttagtatcttatgaaatggggaaaagcttgcaggaaggttttggggaagtacaggaaatg
attgacatctgtgattttgcagtaggtctttcccgtcagctttacggtctcaccatgcac
tctgaaagaccaaaccatcgtatgtatgagcaatggcatccaatgggcattgtgggtatt
atttctgccttcaatttccctgtcgcagtatggagctggaacactgctctggcctgggta
tgcggaaacgtatgtgtttggaaaccctcttcaaaaacccctttatgcgcagttgcctgt
caacatatcattgcaaaagtattaaaggcaaatgatatgcctgaaggaatcagcagctta
ctgatcggaaatgcggttggcgatatgatgaataacgataaacgcattcctttggtttcc
tttaccggatctaccagaattggccgtatggtatctacagcagttgccggcagatttgga
agaagcattctggaattaggcggaaacaatgccattatcatttctaaagatgcagatata
gaaatgtcgattatcggagccgtatttggagcagtaggaacagccggacaacgttgtacc
tctacccgtcgtctgatcatccatgaagacatttacgaagattttaaaaacagactggta
aaagcgtacggtcagcttagaatcggagatccgctggatcagcataaccatgtaggacca
ctaattgacgtttacgcagcagatatgtatactgatgcgattgaaaaaggcaaaaaagaa
ggtgcccgttttgtcgtggaaggtggcatacttagcggcgatcaatatagctcaggctgt
tatgtgaaaccatgtgttgctgaagtagaaaaccattatgagattgtacaggaagaaact
ttcgcaccaatcttatacctgatcaaatataaaaccctggaagaagccatcgccttgcaa
aatggcgttcctcagggactgtcatcagcaatcatgacgctgaacctgagagaggctgaa
caattcttatcagcagcaggatctgattgcgggatcgcaaatgtcaatatcggaacttcc
ggagcagaaattggtggtgcttttggtggcgagaaagaaaccggcggtggtcgagaaagt
ggttctgacgcctggaaagcttatatgcgcagacagacgaataccatcaattatgcgaat
acccttcctttagcacaaggaattaagtttgatttgtaa

DBGET integrated database retrieval system