KEGG   Pedobacter steynii: BFS30_07615Help
Entry
BFS30_07615       CDS       T04469                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
psty  Pedobacter steynii
Pathway
psty00020  Citrate cycle (TCA cycle)
psty00310  Lysine degradation
psty00380  Tryptophan metabolism
psty01100  Metabolic pathways
psty01110  Biosynthesis of secondary metabolites
psty01120  Microbial metabolism in diverse environments
psty01130  Biosynthesis of antibiotics
psty01200  Carbon metabolism
Module
psty_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psty_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFS30_07615
  09105 Amino acid metabolism
   00310 Lysine degradation
    BFS30_07615
   00380 Tryptophan metabolism
    BFS30_07615
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BFS30_07615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOM77044
UniProt: A0A1D7QEK2
LinkDB All DBs
Position
1854040..1856835
Genome map
AA seq 931 aa AA seqDB search
MDNLSYLNGANAEYIESLYQAFKEDPNSVEFGWQKFFEGFDFGRGSSPESVGEETPEHFL
KEVSVLNMINGYRQRGHLFTHTNPVRERRQHLPTLDLENFNLSSADLDTVFNSGVELGIG
AAKLSDIVAFLKQTYCRSIGAEYKYVRTPEVLSWIEHKMESVRNTPNFSIEEKRRILKKL
NEAVSFENFLGTKFLGQKRFSLEGAEALIPALDSVIEKGAELGIEEFVIGMAHRGRLNVL
ANIMQKTYKDIFAEFEGKGYSAASPFGGDVKYHLGYSTDVTTNNGNSVHLSLCPNPSHLE
TVNGVVEGMTRSKIDFKYGGDDARIAPILIHGDASVAGQGIVYEVIQMAGLDGYKTGGTI
HLIINNQIGFTTNFKDARSSTYCTDIAKVTLSPVFHVNGDDVEALVYAINLAMEYRQKYK
NDVFIDILCYRRFGHNEADEPKFTQPLLYKAIEQHANPRDIYVQQLISEGKLEASMAKEM
EKEFRGILQERLNEAKEITSTYQDVKFGGAWADMRLATVQDFETSPNTAVKKTTLLEVAK
RISTLPSDKKFFKKIEKLFDERSKMANTTHVFDWAMGEQLAYGTLLTEGKRVRLSGQDVE
RGTFSHRHAVLTLEDSEEEYIPLANISEQQAPFDIYNSHLSEYGVLGFEYGYAMANPNAL
TIWEAQFGDFFNGAQIVVDQYIASAETKWQRENGLVMLLPHGYEGQGPEHSSARIERFME
LCADYNMQVTNCTTPANFFHAIRRQFKRDFRKPLVVFTPKSLLRHPLCVSKLEEFTDGKF
QEVIEDTNVKAAAVNRVLFCSGKIYYELLEKQQKDQIKDVAIVRVEQLYPTPLAQMEAVY
KKYKNAKEAVWVQEEPENMGAWPYLLRRLRKTIFNDIEVISRKESSSTASGFAKQHADQQ
AYILAKSFEMPVTETEKEIAKKSVSKVYNVD
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggataatttatcttatctcaacggcgcaaatgccgaatacatagagtccctttatcaa
gcttttaaagaagatcccaattcggttgaatttggttggcagaaattttttgaaggcttc
gacttcggtagaggctcatctccggaatcagtaggagaagaaacccctgaacattttcta
aaagaggttagtgttttaaacatgatcaatggttaccgtcagcgtggccacttgtttacc
cacaccaacccggtaagagaaagacgtcagcacctgccaacactggacctggaaaatttt
aacctgtcttccgctgatcttgacactgtttttaattcaggagttgagttgggtatcgga
gcggcgaagctaagtgatattgtagccttcctgaagcagacctactgtcgctcaattggc
gctgaatataaatatgtccgtactccggaagtattgtcgtggatagagcacaaaatggaa
agcgtgcgtaacaccccgaacttttctattgaggagaaacgccgaatcttaaaaaaactg
aacgaagctgtaagtttcgagaatttccttggaacaaagtttcttggtcagaagagattt
tctctggaaggtgcagaagctttaattcctgcgctggactctgttattgaaaaaggtgca
gaacttggaattgaggaatttgtaatcggaatggcgcatcgtggaaggctaaatgttttg
gctaacattatgcaaaaaacctataaggatatctttgctgagtttgaaggtaaaggatat
agtgctgcatcgccttttggtggtgacgtaaaataccatttgggttactcaactgatgtg
accactaacaacggaaatagtgttcacctgagtctatgtccgaacccttcacatctggaa
acagtaaatggagtggttgaaggaatgaccaggtctaaaatagattttaaatatggaggt
gatgatgcacgcatcgcaccaattctgattcatggtgatgcatctgtagcaggtcaggga
attgtatatgaagtaattcagatggcaggccttgatggttataaaaccggaggcaccatt
cacctgattatcaataaccagattggttttaccacaaacttcaaagacgcgcgttccagc
acttattgtacagatattgcaaaagtaactttgtctcctgttttccatgtaaatggagat
gatgtggaggctttggtttatgcaattaacctggcaatggaatatcgtcagaaatataaa
aatgatgtgttcattgacattttatgctatcgcaggttcgggcataatgaggctgatgaa
ccaaaattcacacagccactattgtataaagcgatagagcaacatgccaatccgcgtgat
atctatgtgcagcaactcattagtgaaggtaagcttgaggcaagcatggcaaaagaaatg
gaaaaagaattccgtggtattttgcaggaacgtttgaatgaagcaaaagaaattacttct
acttatcaggatgttaaatttggtggtgcctgggcagatatgcgtctggcaacggtacag
gatttcgaaacttctccaaatacagctgttaagaaaacaactttactcgaagtagcaaaa
agaatcagtactttaccttcagataaaaagttctttaagaaaattgaaaagctttttgat
gaacgtagtaaaatggcgaatacaactcatgtatttgactgggctatgggtgaacaactg
gcttacggtactttgctgacagaaggtaaacgtgttcgtttaagtggtcaggatgtggaa
aggggtactttttctcaccgtcatgcggtattaaccctggaggattctgaagaagaatac
atcccattagcaaacatttctgagcaacaggctcctttcgatatttataattcacattta
tcggagtatggagtgttagggtttgaatatggttacgcgatggctaatccgaatgcatta
accatctgggaagcgcaatttggagatttctttaatggggcacagattgttgtggatcag
tatattgcaagtgctgagacaaaatggcaacgtgaaaatggtttggtgatgttattgcct
catggttatgaaggacaaggaccagagcattcatctgcacgtattgagcgttttatggaa
ctttgtgctgattacaatatgcaggtaaccaattgtacaactcctgcgaatttcttccat
gcaatccgcaggcaatttaaacgcgatttcagaaagccgttagtggtatttaccccgaaa
agtcttttacgtcatccgctttgcgtttctaaacttgaagaatttaccgatggtaaattc
caggaggtaattgaagataccaatgtaaaagcagcagcagtaaacagagtattattctgt
agtggtaaaatttactacgaattgctggagaaacaacaaaaagatcagattaaagatgta
gcgattgtcagggtggagcagttgtatccaactccgttagcacaaatggaagctgtatat
aaaaaatataaaaatgctaaagaagccgtttgggttcaggaagagcctgaaaacatgggc
gcatggccatatttgctacgcagattaagaaaaactatctttaatgatattgaagttata
tcaagaaaagaaagcagcagtactgcatcgggttttgcaaaacaacatgcagatcagcaa
gcgtatattttggctaaatcttttgaaatgccggtgacggaaacagagaaagagattgct
aagaagtctgtgagtaaagtttataatgtagattag

DBGET integrated database retrieval system