KEGG   Pedobacter steynii: BFS30_10795Help
Entry
BFS30_10795       CDS       T04469                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psty  Pedobacter steynii
Pathway
psty00010  Glycolysis / Gluconeogenesis
psty00020  Citrate cycle (TCA cycle)
psty00620  Pyruvate metabolism
psty01100  Metabolic pathways
psty01110  Biosynthesis of secondary metabolites
psty01120  Microbial metabolism in diverse environments
psty01130  Biosynthesis of antibiotics
psty01200  Carbon metabolism
Module
psty_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psty00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFS30_10795
   00020 Citrate cycle (TCA cycle)
    BFS30_10795
   00620 Pyruvate metabolism
    BFS30_10795
Enzymes [BR:psty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BFS30_10795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF2118 PYNP_C Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AOM77612
UniProt: A0A1D7QFY9
LinkDB All DBs
Position
2606038..2607690
Genome map
AA seq 550 aa AA seqDB search
MAEIVRMPKMSDTMTEGVMAKWHKKVGDKVKSGDVMAEVETDKATMDLESYWDGTVLYIG
VEEGKAVPVDAVIAVIGKEGEDYKAALDAEGAAAPSAEAKPATDAAPAEKPAEDKKETPA
GITDADLEKMGVTVVRMPLLSDTMTEGVIAEWHKKVGDKIKNDDILADVETDKATMEVMG
YADGTLLHIGVEKGAAAKVNGIIAIVGPEGTDISGILAQGDAPAKPAADKKADAPVAESA
PSVTAEAATEGSDRVKASPLAKRIAKDKGIDLAQVAGSADGGRIIKKDIENFKPAAAAPA
PAETTSAAPAEKQAQVSIPQFIGEEKYTEKPVTQMRKVIAKRLSESLFTAPHFYLTMAID
MDGAIAARTKINEYAPVKISFNDMVLKAVAIALKQHPNVNSSWLGDKIRYNEHVNIGVAV
AVEDGLLVPVVRFADGKSLSHISAEVKDFAQRAKAKKLQPADWEGSTFTISNLGMFGIDE
FTAIINPPDACILAIGGISQVPVVKNGAVVPGNVMKVTLSCDHRVVDGATGSAFLQTLKA
LLEEPVRLLV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatagttagaatgcccaaaatgagcgacaccatgactgaaggtgtgatggcg
aagtggcataaaaaagttggcgataaagttaaaagtggcgatgtaatggccgaagtggaa
accgataaggcaaccatggatttagagtcatattgggatggtaccgttttgtacattggt
gtagaagaaggtaaagctgttcctgttgatgcggtgattgctgtcataggtaaagaaggc
gaagattataaagcagcgttggatgctgaaggtgctgcggccccatcagctgaagcgaag
ccggcaacggatgccgctcctgcagaaaaacctgctgaagataaaaaagaaacacctgct
ggtattacggatgcggatttagaaaaaatgggtgttactgtagtaagaatgcctttgcta
agtgatacgatgactgaaggcgtgatcgctgagtggcataaaaaagttggtgacaaaatt
aagaacgatgatattcttgccgatgtggaaaccgataaggcgactatggaggttatggga
tacgcagacggaactttattacatattggtgttgaaaaaggtgcagcagctaaagtgaac
ggaattatcgcgattgttggtcctgaagggactgatatcagtggtattcttgcgcaaggc
gatgctccggcaaaacctgcagcagataaaaaagcagatgctccggtagcagaaagcgct
ccgtctgtaacagcagaagccgcgactgaaggttcagatcgcgtaaaagcatctcctctg
gcaaagagaattgcgaaagacaaaggtattgaccttgctcaggtagcaggcagtgctgat
ggcggacgtatcatcaaaaaagacattgaaaacttcaagccagctgcagcagcgcctgca
ccggcagagacaacttctgcagctcctgcagaaaaacaagctcaggtaagtattcctcag
tttatcggcgaagagaaatatacagagaaaccggttactcagatgcgtaaagtaattgct
aaacgtttatctgaaagcctatttacagcgccgcatttctatttaacaatggctattgat
atggatggtgcaattgctgcacgtactaagatcaatgaatatgcgcctgttaaaatctct
ttcaatgatatggtcttaaaagcagttgcgattgctttaaaacaacatcctaatgttaac
tcttcgtggttgggcgataaaatccgttacaatgagcatgtaaacattggtgtagcagta
gctgttgaagatggtctattggttcctgtagttcgttttgcagacggtaaatcactatct
catatctctgcggaagtaaaagattttgcacaacgtgctaaagcgaaaaaattacaacct
gctgattgggaaggttcgactttcactatctctaacttaggaatgtttggaattgatgaa
tttacagcgatcattaacccacctgatgcctgtatccttgcaattggaggaatctctcag
gttccagtggttaaaaacggtgcagtagttccagggaatgtcatgaaagtaaccttaagt
tgtgatcaccgcgtggtggatggtgcaacaggatctgctttcttacagacactaaaagca
ttgttagaagaaccagtaaggttattggtttaa

DBGET integrated database retrieval system