KEGG   Pedobacter steynii: BFS30_15455Help
Entry
BFS30_15455       CDS       T04469                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
psty  Pedobacter steynii
Pathway
psty00500  Starch and sucrose metabolism
psty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFS30_15455
Enzymes [BR:psty01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BFS30_15455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AOM78449
UniProt: A0A1D7QIL3
LinkDB All DBs
Position
3695774..3697975
Genome map
AA seq 733 aa AA seqDB search
MKRIFIALLSLCISTELVNAQDLKSPDGKLLMNFSIQNGGIPTYKLTYKGKVVLKPGKLG
LELKDERPPAKFGAEMGMKSGTDNPKTSLYNQFAIAETKTTSFDETWQPVWGELKNIRNH
YNELAVTLNQKNTDRNILIRFRLFNDGLGFRYEFPQQKNLNYFVIKEEKTQFALSGDMKA
YWIPGDYDTQEYDYTTSKLSEIRGLFRTAVTDNSSQTQYSETGVQAPLMLKSNDGLYISI
HEAALLNYSTMNLNLDDQHMILESWLTPDAKGDKGYMQSPAISPWRTVIVSDDARDILAS
KMTLNLNEPSKIEDTSWIKTSKYIGVWWEMITGKSSWAYTDELPSVQLGVTDYTKVKPNG
KHGANTAHVKEYIDFAAKHGFDGVLVEGWNVGWEDWFGNSKDYVFDFVTPYPDFNVTEIR
DYAKSKGVKMIMHHETSGAVRNYERHMDQAYQFMKDNGYDAVKSGYVGNMIPRGEYHYGQ
WLVNHYQYALEKAAKYKIMLNAHEAVRPTGINRTYPNLIGNESARGTEYQAFGGSKANHV
TILPFTRLIGGPMDYTPGIFEMDISKINPDNKSHLNATLANQLALYVTMASPLQMAADLP
ENYNRFLDAFQFIKDVAMDWDDSKYLEAEPGEYVSVARKAKGTNNWFVGCVAGEDGYTSK
ISFDFLQPGKTYVATIYSDAKDAHYKTNPQAYQIRKVLVNSKSKLTQFAAPGGGYAISII
ETDKSQAKGLKNL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggatatttatcgccttattgtctttatgtatttccactgaactggtaaatgca
caagacctgaaatcgccagatggcaaactgctgatgaacttcagcatccagaatggagga
ataccaacctataagctgacttataaaggtaaagtcgtacttaaaccaggtaaacttggc
ctggagctgaaggatgaaagacctcctgcgaagtttggtgccgagatgggaatgaaatcc
ggaactgacaacccaaaaacttctttatataatcaattcgcaatcgcagagaccaaaaca
accagtttcgacgaaacctggcaaccggtttggggcgagctgaaaaatataagaaaccat
tataatgagctggcggttacgctaaatcaaaaaaatacagacagaaatatcctgatccgc
tttcgccttttcaatgatggcctgggattccgttatgaattcccgcaacagaaaaatctg
aactactttgtgatcaaagaggaaaaaactcagtttgccttatccggcgacatgaaagca
tattggatccctggagattatgatacccaggaatatgattatacgacttctaaactttca
gaaatcagaggattgttccgcaccgcggtaacagacaattcttctcagactcaatattcc
gaaacaggggttcaggctccgctgatgctgaaaagtaacgatggcctttacatcagtatc
catgaagcggcattattgaattattctaccatgaacttaaacctggatgatcagcacatg
attcttgagtcctggttaactccggatgcaaaaggggataagggatacatgcaatctcct
gcaatttctccctggagaacggttatcgtgagtgatgatgcccgtgatattttagcttca
aaaatgactttgaacctgaatgaaccttccaaaatagaagatacctcatggattaaaacc
agtaaatatataggggtctggtgggaaatgattaccgggaaaagttcctgggcttatacc
gacgaattgcctagtgtacagttgggggtaacggattatacgaaagtaaagccgaatggt
aaacatggggcaaatacggcacatgtaaaagaatacattgatttcgccgccaaacatggt
tttgacggtgttctggtagagggctggaatgtaggttgggaagactggtttggcaactct
aaagattatgtgtttgattttgtaaccccttatccggattttaacgtaactgaaatcagg
gattatgctaagagtaaaggtgtgaaaatgatcatgcaccatgagacttcaggtgcggtg
aggaactatgaacgccatatggatcaggcttatcaattcatgaaggacaatggatacgat
gccgtaaagagcggttatgtaggaaatatgatccctcgtggggaataccattatggacag
tggctggtgaaccattatcaatacgcgttggaaaaagcagcaaagtataaaatcatgctg
aatgcacatgaagccgtacgtccgacaggaatcaaccgtacttatcctaacctgattggt
aatgaatctgcccgtggtacggaatatcaggcatttggaggtagtaaagcaaaccatgtt
acgattttgccctttacccgtctgattggtggcccgatggattataccccgggtattttt
gaaatggacatctccaaaatcaatccggataataaatctcacctgaatgcaacgctggcc
aaccagctggcattgtatgtaacgatggccagcccgctccagatggctgccgatctgccg
gaaaattacaatagattcctggatgctttccagtttatcaaagatgtggcaatggattgg
gatgatagtaaatatctggaagccgaacctggtgaatatgtttctgtagcccgtaaagct
aagggaacgaacaactggtttgtgggctgtgtagcaggagaagatggatatacttcaaaa
atttcttttgactttttacagcccgggaaaacttatgtggctacgatttatagcgatgca
aaggatgcccattataaaacaaacccacaggcttatcaaatccgaaaagtcctggtaaac
agcaaatcaaaactaacccagtttgctgctccgggagggggatatgcaatcagtatcatt
gaaacggataaatctcaggcaaaaggactgaagaatctgtaa

DBGET integrated database retrieval system