KEGG   Pedobacter steynii: BFS30_22300Help
Entry
BFS30_22300       CDS       T04469                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psty  Pedobacter steynii
Pathway
psty03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psty00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BFS30_22300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psty03400]
    BFS30_22300
Enzymes [BR:psty01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BFS30_22300
DNA repair and recombination proteins [BR:psty03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BFS30_22300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AOM80961
UniProt: A0A1D7QQQ3
LinkDB All DBs
Position
5394533..5397292
Genome map
AA seq 919 aa AA seqDB search
MSLEKYNKKRDFSKTAEPKAGKPKAEGKLLFVIQKHDASRLHYDFRLEMDGVLKSWAVPK
GPSTDPENKRLAMMVEDHPFDYKNFEGIIPKGEYGGGTVIVWDEGTYEPLEKIKGKKAQE
KHLLAQLKAGSLKIVLHGQKLKGEYALVKTQGMGENSWLMIKHRDDYASTTDIIKKDKSV
LSKKSIEQMEKSSDKVWRNGHEEKLKKPAKAKAKVADEEVAANFTGNGDSESITSERLTP
DVKTLLKRGKKSKIPIGMKPMLATLVDEPFDNPEWIYEVKWDGYRALGFSLKNGDVQLLS
RNNKQFNEKFYPIFELMQSWKMDIAVDGEILVINDKGVSNFGHLQNWRSEADGELVYYVF
DLIWYQGKDLTGLPLSDRQAILAEVLPQEDDRIRLSKVFKTKGTDFFQAATKMGLEGIIA
KKADGQYLKNNRSSEWLKIKVHLRQEVVIAGFTKNEGTSKQFSSLLLGVYENGHLKYVGK
VGTGFNDKDQKEMMAQFEPLVTGKTPFSEEPDVNKASRFRPNPPKAKATWLKPELVCEVA
FAEITSDGVFRHPSFRGMRIDKKAKEVVRESAVETKAIMEMELPDDTETKPVQKDQHASA
IRPPQSTGRKTLLNPKDETQVRKLNGHELKFTHLSKLYWPEDKVSKRDMFNYYYQVADYI
LPYLKDRPMSLNRFPGGIHGKSFYQKDVKGKAPDWTNTFPYTTSEGEHKEYLLGNDSAAL
LWMASLGCIEMNPWFSRSKSPDHPDYCVIDLDPDKNTFDEVIRVAQMVKEVCDQIEVPCY
VKTSGSTGIHIYIPLAAKYTYDQSQMFAKIIVSLVHQQVPEFTSMERMIANRKGKMYLDF
LQNRPGATIAGPYSLRPKPGATVSMPLDWEEVKPGMTMKDFTIFNALDRLKETGDLFKGI
LGNGIDLAKAINKAKEVFG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgaaaaatataataaaaaacgtgattttagtaagacagctgaacctaaggcg
ggtaaaccgaaggctgaaggtaagttgctgtttgtgattcaaaaacatgacgcttcgcgc
ctgcattatgacttccggctggaaatggatggagtgctgaagagctgggcggtgccgaaa
ggaccttctactgatcctgaaaataaaagattggcgatgatggtggaggatcacccgttt
gattataagaattttgaaggtattattcctaagggagagtatggtggcggtacagtgatc
gtctgggatgaaggtacttatgaacctttagaaaaaattaaaggaaaaaaggcacaggaa
aagcatttgctggcacagctaaaggccggttcactgaaaattgtgctacatggtcagaaa
ctcaaaggagaatatgccctggtcaaaactcagggtatgggcgagaatagctggctgatg
atcaaacatagagatgattacgcatcaactactgacatcataaaaaaagataaatctgta
ctttctaaaaagagcatcgaacagatggaaaagagcagtgataaggtctggagaaatggc
catgaggagaagctgaaaaagcctgcgaaagccaaggcaaaagtggctgatgaagaggtt
gcagcaaattttactggaaatggcgatagcgaaagtattacatctgaacggctaaccccg
gatgtaaagactttgcttaaaaggggtaaaaaatccaagattccaattggtatgaaacct
atgctggctactctggtagacgagccttttgataatcctgaatggatttatgaagtgaaa
tgggatggttaccgggccttaggttttagtttgaaaaatggtgacgtacagctgttgtcc
cgcaacaataagcagtttaatgaaaaattctatcctatttttgaattgatgcaaagctgg
aaaatggacatagcggttgatggcgagattctcgtgatcaatgataagggtgtttctaac
ttcggacatttgcaaaattggagaagtgaggcggatggggagctggtttattatgtattt
gatttgatctggtaccaggggaaagatttaaccggactgccactatcggatcgacaggcg
atcctggcagaggtattgcctcaggaggatgacagaattcggttgagtaaggtatttaag
actaaaggaactgattttttccaggccgcgaccaaaatgggactggaaggcattattgcg
aaaaaagcagatggccaatatttgaaaaataaccggtcgtccgaatggctgaagatcaaa
gtgcatcttcggcaggaagtggtcatcgctggttttactaaaaatgaaggcacatccaag
cagttcagttccttgttactgggtgtttatgaaaatggacacctgaagtatgtggggaaa
gtagggacagggtttaacgataaagatcagaaagaaatgatggcacagtttgagccatta
gtcaccggtaaaacacctttttctgaagagccggatgtgaataaagcatcacgttttcgt
cccaatccaccaaaggctaaagcaacctggctgaaacccgagctggtgtgtgaagtggct
tttgcagaaataaccagtgatggtgtattccgtcatccctcttttcgtggaatgcggata
gacaaaaaggcgaaggaggtagttagagagtcggctgtggaaactaaagccatcatggaa
atggaattgcctgatgacacagaaactaaacccgttcagaaggatcagcatgcttcggcg
atccggccaccgcagtctacgggtcgtaagaccctgctcaatcccaaagacgagacacag
gtgcgaaagctgaacggacatgagctgaaattcacgcatttgagtaaactttactggccg
gaagataaagtgagtaagcgtgatatgtttaattattactaccaggtggcagattatatt
ttaccttacctgaaagacaggccgatgtcacttaaccgttttccaggagggattcatgga
aaaagtttttaccagaaggacgttaaaggtaaggcaccggactggacgaatacttttcca
tataccactagcgagggggaacacaaggaatatcttttgggtaacgatagtgcggccctg
ctatggatggcttcactgggttgtatagagatgaatccctggttctccaggagcaaatca
cccgatcatccggattactgtgtgattgatttggatccggataagaatacttttgatgag
gtgattcgtgttgcacagatggtcaaagaagtctgcgaccagattgaggtcccttgttat
gtgaaaacttcaggctctacagggatacacatttacattccattggctgctaagtatacc
tatgatcagtcgcaaatgtttgctaagatcattgtatcgctggtgcatcagcaggtcccg
gaatttaccagcatggaaaggatgatcgctaaccgtaaaggaaaaatgtatcttgatttt
ctgcaaaacaggcccggtgctaccattgccggaccttattccttaaggcctaagcccgga
gcaacggtttccatgcccttggattgggaggaggtaaagcctggaatgacgatgaaggat
tttacgatattcaatgcccttgaccggttgaaagaaacaggcgatctgtttaaaggtatt
ttgggtaatggcattgacctggctaaagctatcaataaggctaaggaggtcttcggatag

DBGET integrated database retrieval system