KEGG   Pedobacter steynii: BFS30_25045Help
Entry
BFS30_25045       CDS       T04469                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psty  Pedobacter steynii
Pathway
psty00564  Glycerophospholipid metabolism
psty01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BFS30_25045
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BFS30_25045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Thi4 Pyr_redox FAD_binding_3 Pyr_redox_3 Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOM81010
UniProt: A0A1D7QQQ6
LinkDB All DBs
Position
complement(6033932..6035494)
Genome map
AA seq 520 aa AA seqDB search
MNRLQLIQNLAAGTQWDVIIIGGGATGLGIAMDAATRGYKTLLVEQADYAKGTSSKATKL
VHGGVRYMAQGDLGLVREACHERGLLLKNAPHLTKNETFVIPNYSWFNNVKYTIGLKFYD
LLAGKLSLGASKYISKKKTIEALPSIRQEGLKGGVVYHDGQFDDSRLALNIAQTAIENGA
TVLNYMKVEGLLKDDKKKVNGIKVKDIETGNSYEAIGKIVINATGVYVDNILKMDKPEAP
HLVRPSQGVHITLDRSFMGGENALMIPETDDGRVLFAVPWHNKLIVGTTDTLVDHAELEP
RALETEIEFILSTAGKYLVKKPMRSDVLAVFAGLRPLAAPKAEGAKTKEISRSHKIIVSD
SGMITITGGKWTTFRRMAQDTLDKAIEKNFLPAKKCVTEELHIHGYVPEPDRADPLHFYG
ADIAGVQKLINENPALQERLVPEYPYTKAMVVWAVRNEFARRVEDVVGRRFRLLFLDVHA
ALAAAPAVAEIIAEELKLDQAWVTQELQDFSTLAKTYTLV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacttcaattgatacagaatttagctgccggtacccaatgggatgtaatcatc
attggtggcggggctacgggtttaggtattgcgatggatgcggccacacgtggttacaaa
actttactggtagagcaggcggattatgcgaaaggaacttccagtaaggcgacgaaactg
gtgcatggtggtgttcgttatatggcacaaggggatcttggtctggttcgtgaggcttgt
catgagagaggtttgttgttgaaaaatgcgcctcacctgacaaaaaatgaaacctttgtg
atcccgaactattcctggttcaacaatgtgaagtataccatcggattgaagttttatgat
cttctggccggcaagctaagtcttggcgcttcgaaatacatcagcaaaaagaaaaccatt
gaagctttgccttctatcagacaggaaggtttaaaaggaggggtggtgtatcatgatggt
cagtttgacgattcccgtctcgcgctgaacattgcgcagactgccattgaaaacggtgca
acggtactgaactatatgaaggtggaaggtttgctgaaagatgataaaaagaaagtaaac
ggtattaaagtgaaagatatagaaaccggtaacagctatgaggcgatcggaaagatcgta
atcaatgcgaccggagtctatgtagataatatcctgaaaatggataaaccggaagcgcca
catctggtgcgtccgagtcagggggtgcacattacgctggaccgttcctttatgggcggc
gaaaatgcgctgatgatcccggagactgacgatggaagggtgctttttgcggtaccatgg
cacaataaactgattgtaggaactaccgatactttggtcgatcatgcggaactggagccc
agagctttggaaacagagattgaatttatcctttctactgcaggaaaatacctggtaaaa
aaaccaatgcgctcggatgtattagcagtgtttgcaggtctacgtccattggcggctccg
aaagcggagggggctaaaacaaaagaaatctccagaagtcataaaatcattgtttcggat
tccggaatgattacgattacgggagggaaatggactactttcagaaggatggcacaggat
acactggacaaagccattgaaaagaactttttaccggctaagaaatgtgtgacggaagaa
ctgcatattcatggttatgtgccagagcctgatcgtgcggatcctttgcatttttacggc
gctgacatcgcaggagtacaaaaactgatcaatgaaaatccggctttgcaggaaagattg
gtgccggaatatccatataccaaagccatggtggtatgggcggtgagaaatgaatttgcc
cgcagggtagaggatgtggtaggccgtcgtttccgtttgttgttcctggatgtacatgcc
gctctggccgctgctccggcagttgcagaaataatagcggaagaactgaagctggaccag
gcctgggtaacacaggagctgcaggacttcagcacattggctaagacctatacactcgtt
tag

DBGET integrated database retrieval system