KEGG   Pedobacter steynii: BFS30_26010Help
Entry
BFS30_26010       CDS       T04469                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
psty  Pedobacter steynii
Pathway
psty00380  Tryptophan metabolism
psty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BFS30_26010
Enzymes [BR:psty01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BFS30_26010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AOM81025
UniProt: A0A1D7QQY9
LinkDB All DBs
Position
complement(6269591..6270880)
Genome map
AA seq 429 aa AA seqDB search
MKFENTLAFAKSLDQADPLSDRRNDFLFPKQNGKPFIYLCGNSLGLQPKAAREVLGQQLS
NWENLAVEGWFEGNSPWMFYHKELKGLMAPIVGASPAEVCPMNTLTVNLHLLMVSFYKPQ
GRRFKIIMEAGAFPSDQYAIESQVRFHGFDPKDAIIEVTPKPGAYTLETADIIAEIEANG
EEIALVLFGGVNYFTGQWFDMEAITKAGHAAGAIVGFDLAHAAGNVPLWLHDWNIDFACW
CSYKYQNSGPGGISGIFVHERHFGDTTLNRFAGWWGYQEQQRFKMEKGFVPEAGADGWQV
SCTQVMPMALYHASLLTFEKAGFIEPLRAKSKTLTSYLIYLINEVNTELGEEQFKVITPA
EEKNRGAQVSIIAKQNGKEVFQQLVARHVLGDWREPNVIRLSPVPMYNSFEDVFLCADLM
LKISKELRS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgagaacactttagcttttgcgaaaagcctggatcaggcagatccgctttca
gataggagaaacgatttcttgtttccgaaacaaaatggaaagccttttatttatctgtgt
ggcaattctttagggttgcaacctaaagcagcacgtgaagtgttgggacagcaattgagc
aattgggaaaaccttgccgtggaaggctggttcgaaggaaacagcccatggatgttttac
cataaagagcttaaaggattgatggcgcccatcgtaggtgcatctccggcagaggtttgt
ccgatgaatacactgaccgtgaatctccatcttttgatggttagtttctacaagccccag
ggccggcgtttcaagattattatggaagccggagctttcccttcagatcagtatgccatt
gaaagtcaggttcgttttcatggctttgatcccaaagatgcaattattgaagtcactcca
aagccgggagcatatacgttagaaacagcagatatcatcgcagagattgaagcaaatggg
gaagagattgcattggtattgtttggcggtgtaaattatttcaccggacaatggtttgat
atggaagccattaccaaagcaggtcatgccgcgggtgcaatagtcggttttgaccttgcc
catgcagctggaaatgttccattgtggttgcacgactggaacatagatttcgcctgctgg
tgctcctataaatatcagaattcaggtcccggaggaatcagtggaatctttgttcatgag
cggcatttcggtgatacgacactgaaccgttttgcgggatggtggggatatcaggaacag
cagcggtttaaaatggaaaagggatttgtacctgaagcgggtgccgatggctggcaggta
agttgtacccaggtgatgcctatggcgctctatcatgcatccctgttaacctttgaaaaa
gcggggtttattgagcccttaagagctaaaagtaaaactttaacttcttaccttatttac
cttataaatgaagtgaatactgagcttggagaagagcaatttaaagtcattacgcctgca
gaggaaaagaaccgtggcgcccaggtttctatcattgcaaaacagaatggaaaggaagtt
tttcagcaattggtagcacgccatgtgttgggcgactggagggagcctaacgtaatccgt
ctaagccctgtcccgatgtataattcttttgaagatgtatttctatgtgcagatctgatg
ctaaagataagtaaggagttgcgctcatga

DBGET integrated database retrieval system