KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1298Help
Entry
Psesu_1298        CDS       T01403                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00020  Citrate cycle (TCA cycle)
psu00190  Oxidative phosphorylation
psu00650  Butanoate metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
Module
psu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psesu_1298
   00650 Butanoate metabolism
    Psesu_1298
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Psesu_1298
Enzymes [BR:psu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Psesu_1298
    1.3.5.4  fumarate reductase (quinol)
     Psesu_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-ProteinID: ADV27146
UniProt: E6WSZ0
LinkDB All DBs
Position
1421120..1422913
Genome map
AA seq 597 aa AA seqDB search
MSAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAAL
ANMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEDGKIYQR
PFGGMTTRYGEGPSAQRTCAAADRTGHAILHTLYQQSLAHNARFMIEYFALDLIMDEEGV
CRGVLALDMAEGTLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVARAGLPLQDM
EFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTIE
IREGRGVGEHKDHILLDLTHLGPGVIDEKLPGIAESARIFAGVDVHKQPIPVIPTVHYNM
GGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVAN
RCAETIKKNAPHKPLASDACDKALSQLDKLRNANGDTPTAVIRDRMQRTMQADAAVFRTS
KTLQEGCEKMSQIFDSFQDVKVSDRSLVWNSDLIETYELHNLLLNAVATINSAEQRKESR
GAHAHEDYPDRDDANWQKHTLVTVDAETGKTSFDYRPVHMYTLSKDVDVVPPKPRVY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctacaagatcaccgaacacaagtacgacatggtcgtcgtcggcgccggtggc
gccggcctgcgcgccaccttcggcctggcccagaagggcctgcagacggtgtgcctgacc
aaggtcttcccgacccgttcccacaccgtggcggcgcagggcggcatctccgccgcgctg
gccaacatgggcgaggacgactggcgctaccacttctacgacaccatcaaggggtcggac
tggctgggcgaccaggacgccatcgagtacatgtgccgcgaggccatcccggccatcatc
gagctggagcactacggcgtgccgttctcccgcaccgaggacggcaagatctaccagcgc
ccgttcggcggcatgaccacccgctacggcgaaggcccgtcggcgcagcgcacctgcgcg
gccgccgaccgcaccggccacgccatcctgcacaccctgtaccagcagtcgctggcgcac
aacgcccgcttcatgatcgagtacttcgcgctcgacctgatcatggacgaggagggcgtg
tgccgcggcgtgctggcgctggacatggccgagggcaccctgcacctgttccgcgcccac
ggcgtggtgctggccaccggcggctacggccgcgcctacttcagcgcgacctccgcgcac
acctgcaccggcgacggcggcggcctcgtggcccgtgccggcctgccgctgcaggacatg
gagttcgtgcagttccacccgaccggcatctacggcgccggctgcctgatcaccgagggc
gtccgcggcgaaggcggcatcctgcgcaactccaacggcgagcgcttcatggagcgctac
gccccgcactacaaggacctggcctcgcgcgacgtggtcagccgttcgatgaccatcgag
atccgcgaaggccgcggcgtcggcgagcacaaggaccacatcctgctcgacctgacccac
ctgggcccgggcgtgatcgacgagaagctgccgggcatcgccgagagcgcccgcatcttc
gccggcgtcgacgtgcacaagcagccgatcccggtgatcccgaccgtccactacaatatg
ggcggcatcccgaccaactaccacggcgaagtcgtgcgcaaggtcggcgacaaccccgat
gcggtggtcccgggcctgtacgcgatcggcgaggccgcctgcgtgtcggtgcacggcgcc
aaccgcctgggttccaactcgttgctggacttggtcgtgttcggtcgcgctgtggccaac
cgctgcgccgagaccatcaagaagaacgccccgcacaagccgctggcctccgatgcctgc
gacaaggccctgtcgcagctggacaagctgcgcaacgccaacggcgacaccccgaccgcg
gtcatccgcgaccggatgcagcgcaccatgcaggccgacgccgcggtgttccgcaccagc
aagaccctgcaggaaggctgcgagaagatgtcgcagatcttcgacagcttccaggacgtg
aaggtctccgaccgctcgctggtctggaactccgacctgatcgagacctacgagctgcat
aacctgctgctcaacgccgtcgccaccatcaactcggccgagcagcgcaaggaaagccgc
ggcgcccacgcgcacgaggactacccggatcgcgacgacgccaactggcagaagcacacc
ctggtgaccgtggacgcggaaaccggcaagaccagcttcgactaccgtccggtgcacatg
tacaccctgagcaaggatgtggatgtggtgccgcccaagccacgcgtgtactga

DBGET integrated database retrieval system