KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1299Help
Entry
Psesu_1299        CDS       T01403                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00020  Citrate cycle (TCA cycle)
psu00190  Oxidative phosphorylation
psu00650  Butanoate metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
Module
psu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psesu_1299
   00650 Butanoate metabolism
    Psesu_1299
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Psesu_1299
Enzymes [BR:psu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Psesu_1299
    1.3.5.4  fumarate reductase (quinol)
     Psesu_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: ADV27147
UniProt: E6WSZ1
LinkDB All DBs
Position
1422936..1423721
Genome map
AA seq 261 aa AA seqDB search
MAEFALPKNSRITKGKHFPAPAGAKNVRTFKVYRWSPDDGANPRTDTYELDLDKCGPMVL
DALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGTNTLACTRAIADCQKAEVPIYPLPHM
SVVKDLVPDLTHFYAQYASIKPWIRTQTPAPPDRERLQSPEDRKKLDGLYECILCACCST
SCPSYWWNGERYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCP
KGLNPALAIAEIKKLMMARRA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttcgcactccccaagaattcccgcatcaccaagggcaagcacttccccgcg
ccggccggcgcgaagaacgtgcgcaccttcaaggtataccgctggagccctgacgacggc
gccaacccgcgcaccgacacctacgagctcgacctcgacaagtgcggcccgatggtcctg
gacgcgctgatcaagatcaagaacgaggttgacccgaccctgaccttccggcgctcctgc
cgcgagggcatctgcggttcgtgcgcgatgaacatcgacggcacgaacaccctggcctgc
acccgcgccatcgcggactgccagaaggccgaggtgccgatctacccgctgccgcacatg
agcgtggtcaaggacctggtcccggacctgacccacttctacgcgcagtacgcctcgatc
aagccgtggatccgcacccagaccccggctccgccggaccgcgagcgcctgcagtccccc
gaggaccgcaagaagctggacggcctgtacgagtgcatcctgtgcgcctgctgctcgacc
agctgcccgagctactggtggaacggcgagcgttacctgggcccggcgatcctgctgcag
gcctaccgctggatcatcgactcgcgcgacgaggacaccggcgcccgcctggacgacctc
gaggatcccttcaagctgtaccgctgccacaccatcatgaactgcgcgcgcacctgcccg
aagggcctgaacccggccctggcgatcgcggagatcaagaagctgatgatggcgcgccgc
gcctga

DBGET integrated database retrieval system