KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1444Help
Entry
Psesu_1444        CDS       T01403                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Psesu_1444
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psu02000]
    Psesu_1444
Enzymes [BR:psu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Psesu_1444
Transporters [BR:psu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Psesu_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADV27291
UniProt: E6WT62
LinkDB All DBs
Position
1591964..1592647
Genome map
AA seq 227 aa AA seqDB search
MLTVHHLENSRSQRVLWLLEELALPYRVVLHKRDPRTLLAPEALRAVHPLGKAPVLVDEG
QALAESGAILEYLVERYDTGHDFSPPQEPTLSEERLLYRYWMHYAEGSAMPPMLLTLVLR
RIRNAPMPFFARPIARALVDRTLSAFVSPQVRLHLDWMEQALDGGGWFAGERFTAADIQM
SFPIEAAAARAGLDSYPNLRGFLERIHARPAYQRALEQGGPFSVATG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccaccaccttgagaactcccgctcccagcgcgtgctctggctgctggag
gaactggccctgccgtaccgcgtggtcctccacaagcgcgaccccaggaccctgctggcg
ccggaggcgctgcgggccgtgcatccgctgggcaaggccccggtgctggtcgacgagggc
caggccttggccgagtccggcgcgatcctggaatacctggtcgagcgctacgacaccggc
cacgatttctcgccgccgcaggagccgaccctttccgaggagcggctgctgtaccgctac
tggatgcactacgccgagggctcggcgatgccgccgatgctgctgaccctggtcctgcgc
cggatccgcaatgcgccgatgccgttctttgcacggcccatcgcccgtgccctggtcgac
cgcaccctgtcggccttcgtctcgccgcaggtcaggctgcacctggactggatggagcag
gcgctggacggtggcggctggttcgccggcgagcgcttcaccgccgccgacatccagatg
agtttcccgatcgaggccgccgccgcgcgcgccggcctggacagctatccgaacctgcgc
ggcttcctcgagcgcatccacgcacgcccggcctaccagcgtgcgctggagcagggcggc
ccgttctcggtcgccaccggctga

DBGET integrated database retrieval system