KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2386Help
Entry
Psesu_2386        CDS       T01403                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Brite
KEGG Orthology (KO) [BR:psu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Psesu_2386
Enzymes [BR:psu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Psesu_2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 AlaDh_PNT_C HI0933_like FAD_oxidored Glutaredoxin DAO Thi4 FAD_binding_3 K_oxygenase FMO-like NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ADV28219
UniProt: E6WVM0
LinkDB All DBs
Position
2609904..2611496
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLQAYLERLTRPVHLIASLDDSAGSKEMLELLQDIEGLSPQVSLEVRRDDAE
RKPSFAITSPGQDINLRFAGLPMGHEFTSLVLALLQVGGHPSKAAADVIEQVKSLEGEFR
FETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQEEVEQRQVMSVPTIYLNGEV
FAAGRMGLEEIVAKLDTGAEEREAGKIAKKAPFDVLVVGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVQHTEGPKLAAALEQHVREYEVDVMNLQRAQALVPAGADG
LVEVKLANGASLKSKTVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLFEFDSKLRADEVLQRKLRSLPNVTIITSAQTTEVLGDG
QKVTGLVYKDRAGGDSHRVELEGIFVQIGLLPNTEWLKGTVELSPRGEIVVDDRGQTSVP
GVFAAGDCTTVPYKQIVIAMGEGAKASLAAFDHLIRTSAPATAPAEEIGA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaacctcaagacccagctgcaggcctatctggaacgcctgacccgcccg
gtgcacctgatcgcctcgctggacgacagcgccggctcgaaggagatgctggagctgctg
caggacatcgaaggcctgtcgccgcaggtgagccttgaagtgcgccgcgacgacgccgag
cgcaagccgtccttcgccatcaccagcccgggccaggacatcaacctgcgcttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggccctgctgcaggtgggtggccat
ccgtccaaggccgcggccgacgtgatcgagcaggtgaagtcgctggaaggcgagttccgc
ttcgagacctatttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaatcccaacatcaggcacgtggccatcgacggcgccctgttccag
gaggaagtcgagcaacgccaggtgatgtcggtgccgaccatctacctcaacggcgaggtc
ttcgccgccggccgcatgggcctggaggagatcgtcgccaagctcgataccggcgcggag
gagcgcgaggccgggaagatcgcgaagaaggccccgttcgacgtgctggtcgtcggcggt
ggcccggccggtgccgcggcggcgatctatgccgcgcgcaagggcatccgcaccggcgtg
gcagccgagcgtttcggcggccaggtgctggacaccatggcgatcgagaacttcatctcc
gtgcagcacaccgagggcccgaagctggccgcggcgctggagcagcacgtgcgcgagtac
gaagtcgacgtgatgaacctgcagcgcgcgcaggccctggtcccggccggcgccgacggc
ctggtcgaagtgaagctggccaacggcgcctcgctgaagtcgaagaccgtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgcctggcgaggaccagtaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcgcacgtc
accctgttcgagttcgactcgaagctgcgtgcggacgaagtgctgcagcgcaagctgcgc
agcctgcccaacgtgaccatcatcaccagtgcccagaccaccgaggtgctgggcgacggc
cagaaggtcaccggcctggtctacaaggatcgcgccggcggcgacagccaccgcgtcgaa
ctggagggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctcaagggcacg
gtggagctgagcccgcgcggcgagatcgtggtcgacgaccgcggccagaccagcgtcccg
ggcgtgttcgccgccggcgactgcaccaccgtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggcgccaaggcgtcgctggccgcgttcgaccacctgatccgcacctcggccccc
gccaccgcccccgcggaggaaatcggcgcctga

DBGET integrated database retrieval system