KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2912Help
Entry
Psesu_2912        CDS       T01403                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00052  Galactose metabolism
psu00511  Other glycan degradation
psu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Psesu_2912
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Psesu_2912
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Psesu_2912
Enzymes [BR:psu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Psesu_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Big_1 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: ADV28736
UniProt: E6WX37
LinkDB All DBs
Position
3169129..3171894
Genome map
AA seq 921 aa AA seqDB search
MTTESPPPARHRARRFAALLLGLATLASGLPAAAEVAPRERIRLDQGWRFHRGDPTGVDG
RLDYDARPQVQASADGKDADSRPDAAVRVQADRPVLKPWILPTANRFIRAPAQRHVPPAT
QPDVGDIPFLRAGYDDSAWPQVTLPHDWAIAGPFLADGPYGGMGRLTSWGIGWYRRQLDI
PADQRGRRIFLNLDGAMSYATVWLNGRLVGGWPYGYNSWRVDLTPYVEFGGNNTLAIRLD
NPPDSARWYPGGGLYRDVWLVSTAPVHVAQWGTTVTTPQVSAEAADVHLRVEVDNTTDRM
VKVAVESEFYELDADGRRGAAPVARIPRIGFQIVPGGSSAAASGATIARPRLWGPPPNQQ
PHRYVAVTTLRQDGQVVDRYETRFGIRQVGWDPDRGVVVNGEHIVLKGVNQHHDLGALGV
AFNVRAARRQLEILRGMGANAIRLAHNPPDPQLLELTDAMGFLVIDEIFDSWEKKKTPLD
FHLVFPEWHEADLRAMLRRDRNHPSVILWSVGNEVGEQYDGEAGAAIGRRLVQIVREEDP
TRPATASMNWAKADMPFPAAFDVINLNYQGEGIRQEPEFEGTERIRTPPSYPAFRTAFPD
KVVFGSETASALSTRGTYLFPVSAAQSAPVRDHNGGDSRRRLVSAYELHAVDFGSSADKV
FATLDRHPYVAGEFVWNGFDYLGEPTPYYESRSSYSGIIDLAGFPKDRYWLYQSRWRPEL
PMAHILPHWNWPGREGQVTPVHVFTSGDEAELFVNGISQGRKKKGAYEYRLRWDEVVYQP
GTLRVQAWRDGRPWASATVETTGAPARLALEADRSRVGNDGRDLSFITLRVLDAKGRAVP
DADTRVRFRIDGAAELVATDNGDPRDLTAFPSAERNAFGGLALAIVRGLPGRSGTARVSV
EADGLEGAVLELRVAPAVDAH
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgagtcgccgcctcctgcgcggcatcgtgcccgccgcttcgccgcgctcctg
ctgggcctggcgacgctggcgtccgggctgccggcggcggcggaagtcgcgccgcgtgaa
cgcatccgcctggaccaaggctggcgcttccaccgcggcgatccgaccggggtggacggt
cgcctggactacgacgcgcggcctcaggtgcaggcaagcgccgacggcaaggatgccgac
agcaggcccgacgcagcggtccgggtgcaggccgaccggcccgtgctcaaaccctggatc
ctgccgacggccaaccgtttcatccgcgctcccgcgcaacgccacgtgcctccggccacg
cagccggacgtcggcgacatcccgttcctgcgcgccggctacgacgactcggcctggccg
caggtcaccctgccgcacgactgggccatcgccggcccgttcctcgccgacggcccctac
ggcggcatgggccgcctgaccagctggggcattggctggtaccggcggcagctcgacatc
cccgccgaccagcgcggccgtcgcatcttcctgaacctggacggcgccatgtcctacgcc
acggtctggctcaacggccggctggttggcggctggccctatggctacaacagctggcgc
gtggacctcacgccctacgtggagttcggcggcaacaacaccttggcaatccgtctggac
aacccgcccgactcggcgcgctggtatcccggcggcggactttaccgcgacgtctggctg
gtcagcaccgcgccggtgcatgtcgcacagtggggcaccacggttaccacgccgcaggtg
tccgccgaggccgccgacgtccacctgcgggtggaagtggacaacaccaccgaccgcatg
gtgaaggtggcggtggagagcgagttctacgagctcgatgcggacggacggcgcggcgcc
gctccggtggcacgcatcccgcgcatcggcttccagatcgtgccggggggcagcagcgct
gccgcgtccggcgccacgatcgcgcggccgcggctatgggggccgccgccgaaccagcag
ccgcaccgctacgtcgccgtgaccacactgcgccaggacggacaggtggtcgaccgctac
gagacgcgcttcggcatccgccaggtcggatgggacccggaccgcggtgtggtggtcaac
ggcgagcacatcgtgctcaagggcgtgaaccagcaccacgacctcggcgcgctgggcgtg
gccttcaatgtccgcgcggcccggcgccagctggagatcctgcgcggcatgggcgccaac
gccatccgcctggcgcacaacccgcccgatccgcagctgctggaactcaccgacgcaatg
ggcttcctggtgatcgacgagatcttcgactcctgggagaagaagaagacgccgctggat
ttccacctcgtgttcccggaatggcacgaggccgacctgcgggcgatgttgcgccgcgac
cgcaaccatccttccgtgatcctgtggagcgtgggcaacgaggtcggcgagcagtacgac
ggcgaggccggcgcggccatcggccggcgccttgtgcagatcgtgcgcgaggaggatccc
acccgtccggccaccgcctcgatgaactgggccaaggccgacatgccgttccctgcggcg
ttcgacgtcatcaacctcaattaccagggcgagggcatccgccaggagccggagttcgag
ggcaccgagcgcatccgcacgccgccctcatatccggcattccgcaccgccttcccggac
aaggtggttttcggcagcgagaccgcctccgcgctgagcacgcgcggcacctacctgttc
ccggtaagcgcggcgcagagcgcgccggtgcgcgaccacaacggcggcgactcccggcgc
cgcctggtcagcgcgtacgagctgcatgcggtggatttcggctccagcgccgacaaggtg
ttcgccaccctcgaccgccatccctatgtggccggcgagttcgtgtggaacggcttcgac
tacctgggcgagcccaccccatactacgagtcgcgcagctcctacagcggcatcatcgac
ctggccggatttcccaaggaccgctactggctgtaccagtcgcgctggcgcccggaactg
ccgatggcgcacatcctgccgcactggaactggcccggccgcgagggccaggtcacgccg
gtgcacgtgttcacctccggcgacgaggccgaactgttcgtcaacggcatttcccagggc
cggaagaagaagggtgcctacgagtaccgcctgcgctgggacgaggtcgtctaccagccg
ggaacgctgcgcgtccaggcctggcgcgatggcaggccgtgggcatcggccacggtggag
accaccggcgcacccgcacgcctggcgctggaggccgaccgctcgcgagtcggcaacgac
ggccgcgacctgtccttcatcaccctgcgcgtgctcgatgccaaggggcgcgcagtgccc
gatgccgatacccgcgtgcgattccgcatcgacggcgccgcggaactggtggccaccgac
aacggcgatccgcgcgaccttaccgcttttccttcggccgaacgcaatgccttcggcggc
ctggccctggccatcgtgcgcggcctgcccggccgcagcgggactgcgcgcgtgagcgtg
gaggccgacggcctggagggcgccgtgctggagctgcgcgtggctccggccgtcgatgca
cactga

DBGET integrated database retrieval system