KEGG   Pelolinea submarina: Pelsub_P0332Help
Entry
Pelsub_P0332      CDS       T05783                                 

Definition
(GenBank) aspartyl-tRNA/glutamyl-tRNA amidotransferase subunit C
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
psub  Pelolinea submarina
Pathway
psub00970  Aminoacyl-tRNA biosynthesis
psub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psub00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pelsub_P0332
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psub03029]
    Pelsub_P0332
Enzymes [BR:psub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Pelsub_P0332
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Pelsub_P0332
Mitochondrial biogenesis [BR:psub03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Pelsub_P0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BBB47105
LinkDB All DBs
Position
358739..360211
Genome map
AA seq 490 aa AA seqDB search
MDALHTLSLKETLQALNDGQVSSLELTRAYLDRIEKLEPQLHTFITLTPELAISMAEAAD
EKRSQLKKNGASMPALLGLPMAIKDVLTVNGVRTTCGSRILENFVPPFNATAVQHLLDEG
MVVLGKTNTDEFAMGSSTENSAYGVTHNPWNTECVPGGSSGGSAAAVAARLAPAALGTDT
GGSVRQPASFCGVTGIKPTYGRVSRYGLIAYGSSLDSAGVLAHSAEDVEIIFRLMAGFDQ
RDSTSIDRPLEDAGCAKASDIKGLRVGVPREYFIEGIQPEVEARVREAIAVLKEQGAEIV
EISLPHTEYALPVYYLIAPAEASANLARYDGVRFGLREENGGVIDMFSKSRGKGFGPEVK
RRIMLGTYALSAGYYDAYYGQAQKVRTLIKADFDQAFERVDVVAAPIAPTTAFKIGGHGD
DPLAMYLEDVFTLPANLAGVPGLAFPVGFDGQHLPVGMQLMGRPFQESTLFRMAHAYQLA
TDWHKQSPSL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatgctttacacaccctatccttaaaagaaacgctgcaagccctgaacgatgggcag
gtttccagcctggaactgacccgcgcgtatctggaccgcattgagaagcttgaaccgcag
ctgcacaccttcatcaccctgacgcctgagctggctatttctatggccgaagcggcggat
gaaaaacgcagccaactgaaaaagaacggcgcaagcatgccggccctgttgggcctgccg
atggcgatcaaagacgtgctgacggtgaacggcgtgcgcactacctgcggctccaggatc
cttgaaaacttcgttccgcccttcaacgccacggctgtacagcatttgctggacgagggt
atggtggtgctgggcaagaccaacacggatgaattcgccatgggctcttccactgagaac
tcagcttacggcgttacgcataatccctggaataccgagtgtgtaccgggtggatccagc
ggcggatcggccgcggcagtggctgcgcgcctggcgccggccgcgctgggcaccgacacg
ggcggcagtgtgcgccaaccggcttccttctgcggcgtgaccggcatcaaacccacttat
gggcgcgtctcgcgttacggcctgattgcctacggttcctcgctggattcggcaggcgtt
ctggctcacagcgccgaagatgtggaaatcatcttccgcttgatggccgggtttgaccaa
cgcgactccaccagcatagaccgtcctttggaagacgccggttgcgcgaaagcctccgat
atcaagggcttgcgcgtgggcgtgcccagggaatatttcatcgaaggcatccagccggaa
gtggaagcgcgggtgcgcgaggctattgccgtgctaaaagaacagggtgctgaaattgta
gagatctccctgccgcataccgagtatgcgctgccggtttattacctgattgccccggcg
gaagcctccgccaacctggcgcgctacgacggcgtgcgcttcgggctgcgcgaggaaaac
ggcggcgtgatcgacatgttttccaaatcgcgcggcaagggcttcggccccgaggtcaag
cgccgcatcatgctgggcacttacgcgctctcggccggttattacgatgcttattacggg
caggcgcagaaagtgcgcacgctcatcaaagccgatttcgaccaggcttttgagcgggtg
gatgttgtggcggcgccgattgcccccactacggctttcaagatcggcggccacggcgac
gacccgctggccatgtacctggaagacgtcttcaccctgccggccaacctggcgggcgtg
cccggcctggccttcccggtcggtttcgacggccagcatctgccggtcggcatgcagttg
atgggccggccgttccaggaaagcactctcttccgcatggcgcatgcttaccagctggcg
accgattggcataagcagtcccccagcctataa

DBGET integrated database retrieval system