KEGG   Pelolinea submarina: Pelsub_P0902
Entry
Pelsub_P0902      CDS       T05783                                 

Definition
(GenBank) PTS system, mannose-specific IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
psub  Pelolinea submarina
Pathway
psub00051  Fructose and mannose metabolism
psub02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:psub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pelsub_P0902
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Pelsub_P0902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psub02000]
    Pelsub_P0902
Transporters [BR:psub02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    Pelsub_P0902
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: BBB47675
LinkDB
Position
1052592..1053413
AA seq 273 aa
MWKEAFYVALVAGGWTLFLKTIPEVIVILTKKESKFAAWWITIMRGIADSATYAYIIPAA
ITGLVLGDLKTGLYVGGTIQLMFLGVFIVGASIPPSPFLASILTTALIILTKANIGEALA
LVVPLSIASQLLTLAFMSLNVFFVHWADKMAEKENSVGLDLLNSLDATGWHLVNVIPAFL
GVGLGVDAAAKLLSIIPDWLSNGLGATGGILPALGFGMLLLIIASNEVWPFFFIGFLLAA
YLNINALAGAILGICFALIYVRLKTANSEKAVK
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtggaaagaagctttttatgttgctttggtggcgggtggttggacgttattccttaag
accattccggaagttattgtcattcttacaaagaaggagagcaaatttgcggcctggtgg
atcaccatcatgcgcggcattgctgactccgccacttatgcatatatcatcccggcggcg
ataaccggtttggtcctgggcgacctaaaaaccggtttgtatgtgggcggcacaatccaa
ttgatgttcctgggtgtgttcattgtaggcgcatccattccacccagcccattcctggct
tccatcctgaccacagctttgatcatcctgaccaaagcgaacatcggtgaagctctggcg
ctggtcgttcccctgtcaatcgccagtcaattgctgacgctggctttcatgagcctgaac
gtgtttttcgtgcactgggctgacaagatggcggaaaaagaaaatagtgtcggattggat
ttgcttaattcactggacgcgaccggatggcatctggttaatgtcattccggctttcctg
ggtgttggtttgggcgttgacgcggcagccaaactgctgtcgatcatccccgattggctt
tcaaacggtttgggcgcgaccggtggtattttaccggcgcttggctttggcatgctgttg
ttgatcattgcttccaacgaagtatggccatttttcttcatcggtttcctgctggcagcc
tatttgaatatcaatgcattagcgggcgctattctcggcatctgcttcgcgttgatttat
gtccggctcaaaacagcgaattccgagaaggctgtgaaataa

DBGET integrated database retrieval system