KEGG   Pelolinea submarina: Pelsub_P0955Help
Entry
Pelsub_P0955      CDS       T05783                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
psub  Pelolinea submarina
Pathway
psub00040  Pentose and glucuronate interconversions
psub00051  Fructose and mannose metabolism
psub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pelsub_P0955
   00051 Fructose and mannose metabolism
    Pelsub_P0955
Enzymes [BR:psub01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Pelsub_P0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BBB47728
UniProt: A0A347ZQZ7
LinkDB All DBs
Position
1120313..1121323
Genome map
AA seq 336 aa AA seqDB search
MSKAKYAAIVHNYNYPTDRFNKEYGIKGANKLILNLIETAGKQGLVKGLEFNMDESPAET
CTGVNMENWKEVKSALDANGLEIIGVAPNLWSSYAFANGTLGAADAKTRKEALDLVKKAM
DLAAKVGSPYVNIWPGQDGYDYYFTTDYPKAYDWWIEGMQAAADYNPDIKLGFEPKPYEP
RSYSTISTVSKSLLMIRDVDRKNVGLNIDVGHMLYAHENLGESVALSMREGNKLFHLHMN
DNYADADADMMFASVHFLAFLEMFYWLRKTNYSGWKSLDLFNYRTDPAASIAEGIRWMMA
FDELIDRVGMDKLEELIKNGNAVENMTFFRKIIFQQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcgaaatacgcggcaattgtacataattacaattacccaactgatcgtttc
aataaagagtatggcatcaagggtgccaacaaattgatcctgaacctgatcgagaccgct
ggaaaacagggtctggtgaaaggcctcgaattcaacatggatgagtcgcctgcagagacc
tgcaccggcgtcaacatggagaactggaaggaagtcaaatccgccttggatgccaatggc
ctggaaatcatcggcgtggcgccgaacttgtggagcagttatgctttcgcaaacggcacg
ctgggcgcagcggatgcgaaaacccgtaaagaagctctggatctggtcaagaaagccatg
gatctggccgcgaaagtgggcagtccctatgtgaatatctggcccggtcaggacggctac
gattattatttcaccactgattatcccaaagcgtatgattggtggattgaaggcatgcag
gcagcggccgattacaaccccgatatcaaactgggttttgaaccgaaaccctatgaacca
cgttcatactccaccatcagcacggtttccaaatccctgttgatgatccgcgatgtggac
cgcaagaatgtcggcctgaacatcgacgtcggccatatgctgtacgcgcacgaaaacctg
ggcgagtcggtcgcgctttccatgcgcgagggtaataagctgttccacctgcacatgaat
gacaattatgcggacgcagacgccgatatgatgtttgcttccgttcatttcctggctttc
ctggaaatgttctattggctgcggaaaaccaactactccggttggaaatccctggatctg
ttcaactatcgtacagacccggctgcttcgattgccgaaggcatccgttggatgatggcg
ttcgacgaattgatcgatcgcgtcggcatggataaattggaagaattgatcaagaatggg
aatgccgtagagaatatgacattcttcaggaagatcatttttcaacagtaa

DBGET integrated database retrieval system