KEGG   Candidatus Planktophila sulfonica: A1sIA56_06680Help
Entry
A1sIA56_06680     CDS       T05158                                 

Definition
(GenBank) eukaryotic-like serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
psuf  Candidatus Planktophila sulfonica
Brite
KEGG Orthology (KO) [BR:psuf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psuf01001]
    A1sIA56_06680
Enzymes [BR:psuf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A1sIA56_06680
Protein kinases [BR:psuf01001]
 Serine/threonine kinases: Other
  Bacterial family
   A1sIA56_06680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal RIO1 Seadorna_VP7 YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: ASY16551
UniProt: A0A249KID7
LinkDB All DBs
Position
1302664..1304211
Genome map
AA seq 515 aa AA seqDB search
MMNSLLGGRYLLGQMIGTGGMADVYIAQDQRLSREVAIKILRSDLAKDPAFVSRFRKEAK
AAAGLNHPAIVAVYDSGEEPAPYIVMELVSGHTLRELIHQGERLPLNRALEIAEGILAGL
EYSHDRHIVHRDIKPANVMITDNGDVKVMDFGIARAMDDLGATLTSTWNVVGTAQYLSPE
QAVGEPADSRSDIYSTGCLLFELLTGQPPFTGETPVSIAYQHASSIAPLVRTLKPELPEG
IETVLAVALSKKPEDRYQSAQAMLDDIAKVRAGEVVTTKVAKKPLFSRRSALLLGGTFFA
AIALSVTGLLMSGGGSNSGPMVPNVVGLSEEMARALLADYSVTIKHAHDGVIPKDRVASQ
LPLATTRAKVGSSVVLTVSDGPGDAIVPDDLIGMSLIDARSALTSVGLLVSQTIASPSDQ
PQGTVLDVMPAVGSVTEAGSSVILTIASGEVTVPNLIGIEAIQAKTLLIQAGFLIKEFYD
YDSAQPAGVVIRQAPDAGTTQTIGKSVTITINRQP
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactcattgcttggcggccgttatcttctcggccaaatgattggcaccggcgga
atggccgatgtctatatcgctcaagatcagcgtctttcgcgtgaagttgctatcaagatt
ctccgtagtgatttagctaaagatcctgcatttgtatctcgcttccgcaaagaggctaaa
gctgcagccggtttgaaccaccctgcaattgttgctgtctatgactctggtgaagaacca
gccccatacattgttatggagctggtctctggacacacgcttcgtgaactcattcatcaa
ggtgagcgacttccactaaaccgcgcactagaaattgctgaaggaattcttgctggtctg
gaatattcacacgatcgacatatcgttcaccgcgatatcaaacctgccaacgtcatgatt
accgataacggtgatgtaaaggtgatggactttggaatcgcgcgcgcaatggatgatctt
ggtgcaacgctaacaagcacatggaatgtcgttggcactgcgcaatatctctcgccagaa
caagcagtcggtgaacccgcagattcacgtagcgatatttactcaaccggttgcttactc
ttcgagcttctaacagggcaaccaccgtttactggcgagactccagtctcgattgcctat
caacatgcatcaagcattgcgccgcttgtacgaacactgaagccagaacttcctgaagga
attgaaactgttctagccgttgcgctttccaagaaaccagaagatagatatcagagcgca
caagcaatgctcgatgacatcgcaaaggttcgcgccggtgaagttgtcacaacaaaggtt
gcaaagaagcctctcttctctcgtcgttcagctcttctcctcggcggaactttcttcgcc
gccattgcactttctgtaacaggcctcttaatgagcggcggcggaagtaattcagggcca
atggttccgaacgttgtcggacttagcgaagagatggcacgtgctcttcttgccgattat
tcagtcaccatcaagcatgcacacgatggcgtgatccctaaagatcgcgtagcaagccag
cttcctcttgcgacaaccagagcaaaggttggctcttctgttgttctcactgtctctgat
ggtccgggagatgcgattgttcctgatgacctaataggtatgtcactcattgatgcgcgc
tctgcactaacttctgtaggtctcttggtctctcaaacaattgcttcaccttctgatcaa
cctcaaggaactgtgctcgatgtaatgccagctgtcggttcggtaactgaggcaggaagt
tcagtaattctcaccatcgcaagtggtgaagtaactgttccaaacttgattggtatcgaa
gcgattcaagcaaagaccttacttattcaagctggtttcttgattaaagaattttatgac
tacgactctgcgcaacctgctggtgttgttattcgccaggcgccagatgcgggaacaacg
cagacgattggtaaatcagtgacgattactatcaatcgtcaaccttaa

DBGET integrated database retrieval system