KEGG   Pseudarthrobacter sulfonivorans: AU252_02340Help
Entry
AU252_02340       CDS       T04210                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00020  Citrate cycle (TCA cycle)
psul00310  Lysine degradation
psul00380  Tryptophan metabolism
psul01100  Metabolic pathways
psul01110  Biosynthesis of secondary metabolites
psul01120  Microbial metabolism in diverse environments
psul01130  Biosynthesis of antibiotics
psul01200  Carbon metabolism
Module
psul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AU252_02340
  09105 Amino acid metabolism
   00310 Lysine degradation
    AU252_02340
   00380 Tryptophan metabolism
    AU252_02340
Enzymes [BR:psul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AU252_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ALV40147
UniProt: A0A0U3P7F2
LinkDB All DBs
Position
532841..534559
Genome map
AA seq 572 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPIAGIIEEIL
VAEDETAEVGAPLVRIGDGSGGGAAPEAAAPAEEAPAAPAEEAPAAEAPAAEAPAAAAPA
ASDGESHDVTLPALGESVTEGTVTRWLKAVGDTVAVDEPLLEVSTDKVDTEIPSPVAGTL
QEIRVNEDETAEVGAVLAVIGSGAAAPAAPAPAPAAAPAPAAAPAPEAAPAPEAPKAEAA
PAAPAAAAAPAPVTAPAPAAEPAAGGESGYVTPLVRKLANQHGVDVASLSGTGVGGRIRK
QDVLAAAEAKAAPPAAAPAKPSAAPAGPAASSLRGTTQKAPRIRQVIARRMRESLETSTQ
LTQVHEVDMTKVAKLRLKAKNSFLAQNGVKLTFLPFIAKAVAEALKQHPKLNAAYDEDKQ
EITYHNAEHLAIAVDTDKGLLVPVVTDAGNLNLAGLAAKIADVAGRTRDGKIGPDELSGG
TFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRPVVVADENGDDSIAIRSMMYLSLTY
DHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagcgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtaggtgaccgggtagaggtggacgaaccgctgctcgaggtttcc
accgacaaagtagacaccgaaatcccctctccgattgccggcatcatcgaggaaatcctc
gtagccgaagacgagaccgccgaagtaggcgctcccctggtccgtatcggcgacggctcc
ggcggcggcgcagcccccgaagcagcagcaccggccgaggaagccccggccgcaccggct
gaagaggccccggccgcagaagcaccggctgcagaagctcccgcagcggctgcacccgca
gcttcggacggcgaaagccacgacgtcaccctcccggcactgggcgaaagcgtcaccgaa
ggaactgtcacccgctggctgaaggccgtgggcgacaccgttgcagtggacgaaccgctg
ctcgaggtatccacggacaaggttgacaccgaaatcccgtcccccgtcgcgggaacgctg
caggaaatccgggtcaacgaagacgaaaccgccgaagttggcgccgtcctcgccgtcatc
ggctccggcgcggcagcccctgcagcccccgcaccggcaccagcagcagcgccggcaccc
gccgccgcgcctgcacccgaagcggcaccggcacccgaagcacccaaggcagaggcggct
ccggcggcacctgccgcggcagcggcacctgctcccgttacggccccggcacccgcggcc
gagcctgccgccggcggcgagtccggctacgtgactcccctggtccggaaactggccaac
cagcacggcgttgacgtcgcatcactgtccggcaccggcgtcggtgggcgcatccgcaag
caggacgtcctcgccgcggcagaagccaaggccgctccccccgcagctgcaccggccaag
ccgtccgccgctccggccggtccggcagcctcctccctgcgtggcaccacgcagaaggct
ccccgcatccggcaggtcattgcccgccgcatgcgcgaatccctcgaaacctccacgcag
ctcacgcaggtgcatgaagtggacatgaccaaggtggccaagctccgcctgaaggccaag
aactcgttcctggcccagaacggcgtcaagctcaccttcctgccgttcattgccaaggcc
gtggccgaggccctcaagcagcaccccaagctcaacgctgcctatgacgaggacaagcag
gaaatcacgtaccacaacgccgaacacctggcgatcgcagtggacacggacaagggcctc
ctggttccggtcgtcaccgatgccggcaacctgaacctggccggactggcagccaagatc
gccgacgttgccgggcgcacccgcgacggcaagatcggcccggacgaactgtccggcgga
acgttcagcatcaccaacatcggttcggtcggcgccctgttcgacaccccgatcatcaac
cagcctcaggtcggcatcctgggcaccggcgcgatcgtcaagcgccccgtggtggtggcc
gatgagaacggtgacgactcgatcgccatccgctccatgatgtacctgtccctcacgtac
gaccaccgtctggtggacggcgcggatgcgggccgcttcctccagaccctgaaggcccgc
cttgaggaaggcgccttcgaggccgacctgggactctag

DBGET integrated database retrieval system