KEGG   Pseudarthrobacter sulfonivorans: AU252_07450Help
Entry
AU252_07450       CDS       T04210                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00511  Other glycan degradation
psul00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AU252_07450
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AU252_07450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:psul02042]
    AU252_07450
Enzymes [BR:psul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AU252_07450
Bacterial toxins [BR:psul02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AU252_07450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 NPCBM_assoc BNR Sortilin-Vps10 CARDB N_BRCA1_IG
Motif
Other DBs
NCBI-ProteinID: ALV41009
UniProt: A0A0U3R753
LinkDB All DBs
Position
complement(1701339..1704317)
Genome map
AA seq 992 aa AA seqDB search
MDLRISTKRNRHRSIGRTAGAGLVALALLAGSGIAAQAAPIPPNNLTAPPGSFAEANNGA
DRTAANFFYRIPALTYLGNNVVLASWDGRPGSAADAPNPNSIVQRRSTDGGQTWGPVQVI
AAGHVGDATGPKYGYSDPSYIYDAEAGKVFALFVYSKDQGFFGSQFGNDDADRSVISSAV
IESSDGGVTWTQPRLITNVTKPGTSKTSPVAGDIRSNFASSGEGIQLKYGQYKGRLVQQY
AGDVRQADGTNKIQAYSVYSDDHGVTWHKGANVGDRMDENKTVELSDGRVMLNSRDNANQ
GYRKVAISTDGGATYGPVTQDTELPDPANNGSIARMFPAAAQGSADAKKLIFTNSNSKTG
RENVSARISCDDGATWPGVRTVRSGFSAYSTVSRLGDGKFGVLYEGNYTDNIQFAKFDDA
WLNYACAPLSVPALTTTAGATKQVAVTVTNQEATTLSGANATVYTPTGWTATTVPVPDVA
PGASATVNVDLTAPANASGPQNLNAAFTTADGRVSQFTFTATVPAAPQVGLTITGTAPAR
DVIASPYQAGDVLGYTFNVKSTANVTANSEPTSGNFETGFLPPAPGAPSVPNCRFNSLAA
GANYNCTTAKHTLTAEDIARGYFVPEASFTVTASATPSLTKTVPFTGAAVALRDGLVSAS
ITGARGDEGRDLATQPYATGDAFPYTFSVSNTSPLVEKVVPTAGNFSPFVPEGPGNCRYG
VLPAGQGYTCATPRHTVTGAEAEQGYFVPKTTWEVSSAGQSSKVYTVDGGELDLKVRDAK
LEGTVSAEWSDADGDRFASEGDTVSYAYTVGNAGNVALTGLSAPDASISQDALAVGGTVT
ATREHVLTAADIAAGRLDAVSFAATATNGAKEVTATVTGGALVLALLPSQPETVPVLAVQ
DLEEQTAPFDLGTQDKYRNGQKVTLKGLDYGQWYYVYLNKKSYRIGWIFPTTDNTVEFIL
PSGVQSGRDDVVVLDKDGKQVSFDRLQVTPKG
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcgaatttctactaagcggaacaggcaccgaagtattggccggaccgcagga
gccgggctggtagcgctggcgctgctcgccggatccgggatcgccgcgcaggcggcaccg
atccccccgaacaacctcaccgctcctcccggctcattcgcggaggccaataacggcgcc
gaccggactgcggcgaacttcttctaccggatcccggccctgacctacctgggcaacaac
gtggtgctcgcctcgtgggacggccgccccggcagcgctgcagacgctccgaaccccaac
tcgatcgtgcagcgccgcagcaccgacggcggccagacctggggccccgtgcaggtcatc
gccgccggccacgtgggcgacgccacgggccccaaatacggctacagtgatccgtcctac
atctacgacgccgaggccgggaaggtcttcgcgctgttcgtgtactccaaggaccagggc
ttcttcggcagccagttcggcaacgacgacgccgaccgcagcgtgatctcctccgccgtg
atcgaatcctccgacggcggcgtcacgtggacgcagccaaggctcatcaccaacgtcacc
aagccgggcaccagcaagaccagtccggtggccggcgatatccgctccaacttcgcgtcc
tccggcgaaggcatccagctcaagtacggccaatacaagggccgcctggtccagcagtac
gccggcgatgtgcgccaggccgacggcaccaacaagatccaggcctacagcgtctactcg
gacgatcacggcgtgacctggcacaagggcgccaacgtgggcgaccgcatggacgagaac
aaaaccgtggaactttccgacggccgcgtaatgctgaactcgcgcgacaacgccaaccag
ggctaccgcaaggtggccatctccactgacggcggcgccacctatggtccggtcacccag
gacaccgaactgccggacccggcaaacaacggttccatcgcccggatgttcccggccgcg
gcccagggctcagcggacgccaagaagctcatcttcaccaactccaattccaagaccggc
cgcgagaatgtctctgcccgtatctcctgcgacgacggcgccacctggcctggtgtgcgc
accgtccgctccggtttctccgcctactccaccgtgtcccggctcggggacggcaagttc
ggtgtcctgtatgaaggcaactacacggacaacatccagttcgcgaagttcgacgacgcc
tggctgaactacgcctgcgccccgctgtccgtaccggcactcaccaccaccgccggcgcc
accaagcaggtagcggtcaccgtgaccaaccaggaggccaccacactttccggcgccaac
gccacggtctacactcccaccggctggaccgccaccacggtgcccgtgcccgacgtcgcg
cccggcgcctcggccaccgtcaatgttgacctgaccgcaccagcgaacgccagcggtccg
cagaacctgaacgctgcctttacgacggcggatggccgggtttcgcagttcaccttcacc
gccaccgtcccggcagctccgcaagtgggcctcaccatcaccggaacggctccggcccgc
gacgtcatcgccagcccctaccaggcgggtgacgtcctgggctacacgttcaacgtcaag
agcaccgccaacgtcacggcgaattcagagcccacatccggcaactttgagacaggcttc
ctgccgccggcccccggcgcacccagtgttccgaactgccggttcaacagcctggccgcg
ggtgcaaactacaactgcaccacggccaagcacacgctgacggccgaggacatcgcccgc
ggctacttcgtccccgaggcgagtttcacggtcacggccagcgcgacgccgtcgctcacc
aagacggttccgttcaccggcgccgcggtggcactgcgtgacggtctggtttccgccagc
atcaccggtgcccggggcgacgaggggcgcgatcttgccactcagccgtacgctaccggc
gatgccttcccgtacacgttcagtgtgagcaacacgagcccgctcgtggaaaaagtggtc
cccaccgccggtaacttcagcccgttcgttcccgaaggcccgggcaactgccgctacggc
gtgctgccggccggccagggctacacctgcgccacgccgcgccacaccgtgaccggtgcc
gaggcggagcagggctacttcgttccgaagaccacgtgggaagtcagttccgcaggccag
agcagcaaggtctacacggtcgacggtggcgaactggacctgaaggtccgcgacgccaaa
ctggaaggcaccgtttcggctgagtggagcgacgccgacggtgaccgtttcgccagcgaa
ggcgataccgtctcatacgcctacaccgtaggcaacgccggcaacgtcgccctgaccggg
ctcagtgccccggacgcctccatcagccaggacgccctggccgttggcgggaccgtgacg
gcaacgcgcgagcacgtcctgaccgcagccgacatcgcggcaggccggctcgacgcggtc
tcgttcgcggcaactgccaccaacggcgccaaggaagtcaccgccacggtgaccggcggc
gcgctggtgctggctctcctgccgtcgcagcccgagacggtccccgtcctcgccgtccag
gaccttgaggaacagacggctccgttcgacctcggcacgcaggacaagtaccgcaacggc
cagaaggtgaccctgaagggtctcgactacggccagtggtactacgtgtacctgaacaag
aagagctaccggatcggctggattttccccaccaccgacaacaccgtggagttcatcctg
ccctcaggtgtgcagagcggccgcgacgacgtggtggtgctggacaaggacggcaagcag
gtctccttcgaccggctgcaggtgacgcccaagggctga

DBGET integrated database retrieval system