KEGG   Pseudarthrobacter sulfonivorans: AU252_10715Help
Entry
AU252_10715       CDS       T04210                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
psul  Pseudarthrobacter sulfonivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase YidC_periplas PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: ALV41562
UniProt: A0A0U3Q8M2
LinkDB All DBs
Position
2393683..2394777
Genome map
AA seq 364 aa AA seqDB search
MQLPVMPPVPPMLAKAVSGMPDGALSYEPKWDGFRSIIFRDGDELEIGSRNEKPMTRYFP
ELVEALKENLPPRCVLDGEIVLVGASGDRLDFDALQQRIHPAASRVKLLAEQTPAKFVAF
DLLALGDDDYTGRPFAERRAALEKALAGSKAPVHLTAATQDKATAEQWFQQFEGAGLDGI
VAKPLEGSYQPDKRVMFKVKHERTADCVVAGYRVHKSGPDAIGSLLLGLYKDDGGLASVG
VIGAFPMKRRQELFEELQTLVTDFDGHPWAWAKQAEGERTPRNAEGSRWSAGKDLTFVPL
RPELVVEVRYDHMEGERFRHTAQFSRWRPDRDPESCTYAQLEEPVNFDLASVLETGRPQA
PSSP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcccgtgatgcctcccgtcccgcccatgctcgccaaggccgtcagcggaatg
cccgacggggccctcagctatgagcccaagtgggacgggttccggtccatcattttccgc
gacggcgatgagctggagatcggcagccgcaacgaaaagcccatgaccaggtattttcct
gagctcgtggaagccctgaaggaaaacctgccgccccgctgtgtgctggacggcgagatt
gtcctggtgggggcatccggtgaccggctggatttcgatgccctgcagcagcgcatccat
cctgccgccagccgcgtcaagctcctcgccgaacagacccccgccaagtttgtggccttt
gacctgctggccctgggcgacgacgactacaccggccggcccttcgccgaacggcgggca
gcgctggaaaaggcgctggcgggcagcaaggctcccgtccatctcacggcggcgacccag
gacaaggccaccgccgagcaatggttccagcagttcgaaggtgcaggcctggacgggatt
gtggccaagccgctggaggggagctaccagccggacaaacgcgtgatgttcaaggtcaag
cacgaacgtacggccgattgtgtggtggccggctaccgcgtgcacaagagcggaccggac
gcgatcggctcgttgctgctgggcctgtacaaggacgacggcggcctggccagcgtgggc
gtgatcggcgccttcccgatgaagcgccggcaggagctgttcgaggaactccagacgctg
gtcacggacttcgacggacatccctgggcctgggccaagcaggcggaaggcgaacggacg
ccgcgcaacgcggaggggagccggtggagcgcgggcaaagatctgacttttgtgccgctc
cggcccgaactggtggtggaggtcaggtacgaccacatggaaggtgagcgcttccggcat
accgcccagttctcgcgctggcggccggaccgggatcccgaatcctgcacttacgcccag
ctggaggagccggtgaactttgacctggcgtcggtgctggagaccggccggccgcaggcg
cccagttcaccgtag

DBGET integrated database retrieval system