KEGG   Pseudarthrobacter sulfonivorans: AU252_14715Help
Entry
AU252_14715       CDS       T04210                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AU252_14715
Enzymes [BR:psul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AU252_14715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ALV42241
UniProt: A0A0U3RAR7
LinkDB All DBs
Position
complement(3251415..3253454)
Genome map
AA seq 679 aa AA seqDB search
MSVQRNSGPASVWSNVEGIAYGGDYNPEQWPADIRLEDLELMKEAGVSFLSVGIFSWALL
EPAEGEYNFGWLDEVMDNLAATGIKVALATATAAPPAWLIRKHPEILPVTADGTVLGPGS
RRHYTPSSAVYRRYATGITRVIAERYKDHPALALWHVDNELGCHVSEFHGAEDAAAFRTW
LERRYGSIEALNAAWGTAFWSQNYGSFEEILPPGVAPSTLNPGQQLDFQRFNSWALMDYY
RALVAVLRDVTPGVPCTTNLMASSATKALDYFEWAKDLDVIANDHYLVAADPERQIELAF
SADLTRGIAGGDPWILMEHSTSAVNWQPRNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SFAGSEKFHSAMVPHGGRDTRVWREVVELGSVLKRLAPVRGSRVESRVAIVFDYEAWWAS
EIDSKPSEDVKYLDVLRAFHRSLFLRGIAVDLVHPSSPLEGYDLVLVCTLYSVTDAAAAN
IAAEARAGATVLVTYFSGIVDEQDHVRLGGYPGAFRELLGIRVEEFHPLLAGGQLKLSDG
GVSSVWSEHVHLAGAEAVQTFTEYPLEGVPSLTRHAVGSGDSAGAASGAAWYLATFPDRD
GIEAVVDRLLAESGVAPVAAADRGVELVRRRTDDGGSFLFAINHSRSAAAVEAAGVDLLT
GARFAGTVEAGSVAVIAED
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcagcgtaattccggcccggccagcgtttggagcaacgtggaagggatcgcg
tacggcggcgattacaaccccgaacagtggcccgcggacatccggctggaagacctggag
ctcatgaaggaagccggcgtcagtttcctgagcgtgggcattttctcgtgggccttgctc
gaaccggctgagggcgaatacaacttcggctggctggatgaagtgatggacaatctcgcc
gccaccgggatcaaggttgccctggcgaccgccaccgctgctcccccggcctggctcatc
cgcaaacacccggaaatcctgccggtcacggctgacggaacggtgctgggaccgggctcc
cggcggcactacacaccgtcgtcggccgtgtaccgccggtacgccaccggcatcacgcgg
gtgatcgccgagcggtacaaggaccaccccgcgctggcgttgtggcatgtggacaacgag
ctcggctgccacgtctccgagttccatggcgcggaggacgccgcggcgttccgcacgtgg
ctggagcgccggtatggcagcatcgaggcgctgaacgcggcctggggcacggcgttctgg
tcccagaactacggttccttcgaggagatcctgccgcccggcgtcgcgccttccacgctg
aatccgggccagcagctggacttccagcggttcaattcgtgggcgctgatggactactac
cgcgcgctggtggcggtcctgcgggatgtcacccctggggtgccctgcaccaccaacctg
atggcgtccagcgccacgaaggccctggactatttcgagtgggccaaggacctggacgtc
atcgccaacgaccactacctggtggccgcggatcccgagcggcagatcgaactcgcgttc
agcgcggacctgacccggggaattgcgggcggtgacccgtggatcctgatggaacattcg
acgtcggccgtcaactggcagccgcgcaatcagcccaagatgcccggcgaaatgctgcgc
aactcactggcccatgtggcccgcggggcggacgcggtgatgttcttccagtggcggcag
agctttgccgggtccgagaaattccactccgcgatggtcccgcacggcggccgtgacacg
cgggtgtggcgcgaggtggtggagctcgggtctgtgctgaagcggctcgcgccggtgcgt
ggctcacgggtggaatcccgcgtggcgatcgtcttcgactacgaagcctggtgggccagc
gaaatcgactccaaaccgagcgaggacgtgaagtacttggacgtgctgcgggcgttccac
cggtcgctattcctgcgcgggatcgcggtggatctggtccatccttcttcgcccttggag
ggctacgacctggtcctggtgtgcacgctttattcggtgactgacgcggccgctgcgaac
atcgctgccgaggcgcgggccggagccacggtgctggtcacgtatttcagcgggattgtg
gacgaacaggaccacgtccggctgggcggctaccccggcgcgttccgggagctgctgggg
atccgcgtggaggaattccacccgctgctggccggcgggcagttgaagttgagcgacggc
ggggtctcgtccgtgtggagtgagcacgtgcacctcgccggcgctgaggccgtgcagact
ttcaccgagtatccgttggagggcgtgccgtcgctgacgcggcatgcggttggctcgggt
gatagtgcgggcgctgcttccggtgcggcctggtacctcgcgacgttcccggaccgcgac
ggcatcgaagcggtcgtggaccggctgctggccgaatccggcgtcgctcccgttgccgcc
gccgaccgcggcgtggaactcgtacgtcgacggaccgacgacggcggcagcttcctgttc
gcgatcaaccactcacgctcagccgcggcggtggaggccgccggcgttgacctcctgacg
ggcgcgcggtttgcggggaccgttgaggccggttccgttgcggtgatcgcggaggactga

DBGET integrated database retrieval system