KEGG   Pseudarthrobacter sulfonivorans: AU252_17445Help
Entry
AU252_17445       CDS       T04210                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00564  Glycerophospholipid metabolism
psul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AU252_17445
Enzymes [BR:psul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AU252_17445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DnaG_DnaB_bind SRP_SPB NAD_binding_8 Pyr_redox Herpes_UL4
Motif
Other DBs
NCBI-ProteinID: ALV44039
UniProt: A0A0U3FYC9
LinkDB All DBs
Position
3841597..3843336
Genome map
AA seq 579 aa AA seqDB search
MNTVPNEGGVLGPAAREASIARLRATSEPGNELDILIVGGGIVGAGAALDAVTRGLSVGI
VEASDWAAGTSSRSSKLIHGGLRYLEMLDFGLVKEALHERGLILSVLAPHLARPVPFLYP
LTKPFLERPYVGAGIALYDAMSITGGHSRGVPFHKHLTRRGTLRAAPSLKKDAFVGSIRY
YDGQVDDAKYVANLVRTGVHYGAHAVNQMAVVDFLREGERVVGAKVVNHEDGSQFKIKAK
QVINATGVWTDETQAMVTDRGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVLFVIPW
GRHWIIGTTDTDWNLDKAHPAASSKDIDYILEHVNRVLKRPLTREDVEGVYAGLRPLLAG
ENDSTAKLSREHIVAHPVPGLVVVAGGKWTTYRVMAKDAVDEATRTMDERVPASCTETIP
LLGASGFKAAWNRRSRTAEESGVHVARVEHLLNRYGSMTPEVLDIIARNPELAEPLPGAD
DYLQAEAVYAATHEGARHVHDVLTRRTRISIEAWDRGVSAVPVVAKLMGEVLGWSDVQRE
SEIKHYIARVEAERLSQQQPDDESADAARLGVEDIVPLR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgaacactgttccaaacgaaggcggggtccttggtcccgcggccagggaagcatcgatt
gccaggctcagggccacctcggaacccggcaacgaactggacatcctgatcgtcggcggc
ggcatcgtgggcgccggcgcggcgctggatgccgtgacccgcggcctcagtgtggggatc
gtggaggccagcgactgggcggccggcacgtcgtcacggtcatccaagctgatccacggc
ggcctgcgctacctggagatgctggattttgggctggttaaggaagcgctgcacgaacgt
ggcctgattctttcggtcctggccccgcacctggcccggcctgtgccgttcctgtatccg
ctgaccaaaccgtttctggagcggccctatgtgggcgccgggatcgccctctacgacgcc
atgtccattaccggcgggcacagccgcggcgttccgttccacaaacacctcaccaggcgg
ggcaccctcagggccgcccccagcctgaaaaaagacgcctttgtgggctccatccgctat
tacgacggccaagtggatgacgccaagtacgtggcaaacctcgtccgcacgggagtgcac
tacggcgcgcatgcggtgaaccagatggcggtggtggatttcctgcgtgaaggcgagcgc
gtggtgggtgccaaagtggtcaatcacgaagacggttcgcaattcaagatcaaagccaaa
caggtcatcaacgccaccggggtgtggaccgatgaaacccaggccatggtcaccgaccgc
gggcagctgaaggtccgggcgtccaagggcatccacctcgttgtgccccgcgaccggttc
cagtccacggtggggctgatcctccgcaccgaaaagtccgtgctgttcgtcattccgtgg
ggccggcactggatcatcggcaccacggatactgactggaacctcgacaaggcccacccg
gcggcctccagcaaggacatcgactacatcctcgagcacgtcaaccgggtcctgaaacgc
ccgctgaccagggaggacgttgaaggcgtctacgccggactgcgcccgctcctggcaggg
gagaacgattccacggcgaaactgtcccgtgaacacatcgtggcccaccccgtaccgggc
ctggtagtggtggcaggcggcaaatggaccacctaccgggttatggccaaggacgccgtg
gacgaggccacccgcaccatggatgagcgggtcccggcgagctgcaccgaaaccatcccg
ctgctgggcgccagtggcttcaaggcggcctggaaccgccggagccggaccgctgaagag
tccggcgtgcacgtggcccgggtagagcacctgctcaaccgttacgggtccatgactccg
gaggtgctggacatcatcgcccggaatcctgaattggcggagccgttgcccggtgctgac
gactacctgcaggccgaagccgtctacgccgcaacccacgagggtgcccggcatgtccat
gacgtgctgacccggcggacccgtatctccatcgaggcctgggaccgtggcgtgtcggcg
gtgccggttgtcgctaaactgatgggcgaagtccttggctggagcgatgttcagcgtgaa
agcgaaataaagcactacatagcacgcgttgaagctgaacggctgagccagcagcagccg
gatgacgaatccgccgacgccgcacggctgggtgtggaggacatcgtcccgttgcgctga

DBGET integrated database retrieval system