KEGG   Pseudarthrobacter sulfonivorans: AU252_19250Help
Entry
AU252_19250       CDS       T04210                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00473  D-Alanine metabolism
psul00550  Peptidoglycan biosynthesis
psul01100  Metabolic pathways
psul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AU252_19250
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AU252_19250
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AU252_19250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psul01011]
    AU252_19250
Enzymes [BR:psul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AU252_19250
Peptidoglycan biosynthesis and degradation proteins [BR:psul01011]
 Precursor biosynthesis
  Amino acid ligase
   AU252_19250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ArlS_N
Motif
Other DBs
NCBI-ProteinID: ALV43030
UniProt: A0A0U3GV62
LinkDB All DBs
Position
4242001..4243149
Genome map
AA seq 382 aa AA seqDB search
MSDDNLTAADSAPRAKPRVAVLFGGRSSEHAVSCVTAAGVLGAINKDKYDVIPIGIAKSG
QWVLAAGDTAQWSLSASSLPEVPPSSETVTLAEIGGEHQLIVASPNQIPQELGTVDVVFP
LLHGPFGEDGTIQGLLELSDTRYVGAGVLASAVGMDKHYMKVVFEAAGLHVGPYIAVTDR
QWVKDAEAVRKQVDQLGFPVFVKPARAGSSMGISKVDSLEGLDAAVEEARRHDLKLVIEA
GIVGREIECAVLEGRGTDSPRTSMPGEISVAAGTHEFYDFNAKYVEDDAAALSCPADIPD
EAIVRVRELAAAAFDAVGAEGLSRVDFFYTPDGELIINEINTMPGFTPKSMYPQMWAASG
LNYADLIDELIHLALNRKTGLR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgataacctgaccgcagcggactccgccccccgggccaaaccccgcgtcgcg
gtcctctttggtggccggtccagtgaacatgccgtgagctgcgtgaccgccgccggcgtc
ctgggcgccatcaacaaagacaagtacgatgtcatccccatcggcatcgccaagtcgggg
cagtgggtgctggctgcgggggataccgcccagtggtcgctgtccgcgtcgtcgctgccg
gaggtcccgccgtcgtcggaaacggtgacactggccgagatcggcggcgagcaccagctg
atcgtcgcctcacccaaccagataccgcaggaactcgggacggtggacgtcgtatttccc
cttctccatggtccctttggcgaggacggcaccatccaggggctcctggaactgtccgac
actcgctacgtcggcgccggcgtgcttgcgtcggctgtgggcatggacaagcactacatg
aaggttgtgttcgaggccgccgggctgcacgtggggccctacattgccgtcacggaccgc
cagtgggtcaaggacgcggaggccgtccgcaagcaggtggaccagctcggctttcccgtg
ttcgtcaagccggcgcgggcgggttcgtccatggggatctccaaagtggactcgctcgag
ggactcgacgccgccgtcgaggaagcccggcgccatgacctcaaactggtcatcgaggct
ggcatcgtagggcgtgagattgagtgcgcggtcttggaaggacgcgggaccgattccccc
cggacgtccatgccgggcgaaatttccgtcgctgccggaacgcacgaattctacgatttc
aacgcgaagtatgttgaggacgacgccgccgcgcttagctgccccgccgacattcccgac
gaagccatcgtgcgggtccgggaactcgcagcagctgccttcgacgctgtgggtgcggaa
ggcctgagccgcgtggacttcttctacacgcccgacggcgaactgatcatcaacgagatc
aacaccatgcccgggtttacgcccaaaagcatgtacccgcagatgtgggcagcatcaggc
ctgaactacgcggacctgattgatgagctgatccatctggccttgaaccggaagaccggc
ctgcgctag

DBGET integrated database retrieval system