KEGG   Phytohabitans suffuscus: Psuf_017140
Entry
Psuf_017140       CDS       T06545                                 

Gene name
uppS1
Definition
(GenBank) isoprenyl transferase 1
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00900  Terpenoid backbone biosynthesis
psuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psuf_017140 (uppS1)
Enzymes [BR:psuu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     Psuf_017140 (uppS1)
SSDB
Motif
Pfam: Prenyltransf TetR_C_25
Other DBs
NCBI-ProteinID: BCB84401
UniProt: A0A6F8YEM6
LinkDB
Position
complement(1970161..1970964)
AA seq 267 aa
MVRTLRRRQPIAPTPHTSGARPPALPRESLPRHIAIVMDGNGRWAKERGLTRTKGHEQGE
HSLFDTIEGAIELGIPYLSAYAFSTENWRRSPEEIRFLMGFNRDVIRRRRDQLVDLGVRV
VWSGRAGRLWKSVISELVTAEDMSRGNSTLTLQFCVNYGGQAEIADAAAAIARDVAAGKV
SPDKVNEKMIARYLYHPEVPEVDLFLRPSGEQRTSNFLLWQSAYAEMVFLDTLWPDFDRR
HLWYACELYAQRDRRFGGALPNPVAPS
NT seq 804 nt   +upstreamnt  +downstreamnt
ttggttcgcacacttcgccgccggcagccgatcgcgccgacaccgcacacgtccggcgcg
cgcccgcccgcactgcccagggagagcctgccgcgccacatcgcgatcgtgatggacggc
aacgggcgctgggcgaaggagcgcggcctgacccggacaaaggggcatgagcagggcgag
cactcgctcttcgacaccatcgagggcgccatcgagctgggcatcccgtacctgtcggcg
tacgccttctcgacggagaactggcggcgctcgccggaggagatccggttcctgatgggc
ttcaaccgcgacgtgatccgccgccgccgcgaccagctcgtcgacctcggcgtgcgggtg
gtgtggtccgggcgggccggccggctgtggaagagcgtgatctccgagctggtcaccgcc
gaggacatgtcgcgcggcaactcgacgctgaccctgcagttctgcgtcaactacggcggc
caggccgagatcgccgacgcggccgccgcgatcgcccgcgacgtcgccgccggcaaggtc
tcacccgacaaggtgaacgagaagatgatcgcccggtacctctaccaccccgaggtgccc
gaggtcgacctcttcctgcgcccctccggcgagcagcgtacgtccaacttcctgctgtgg
cagtcggcgtacgcggagatggtcttcctggacacgctctggcccgacttcgaccggcgc
cacctctggtacgcctgcgagctgtacgcccagcgcgaccgccgcttcgggggcgcactg
cccaacccggtcgcgcctagctga

DBGET integrated database retrieval system