KEGG   Phytohabitans suffuscus: Psuf_020560
Entry
Psuf_020560       CDS       T06545                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00997  Biosynthesis of various secondary metabolites - part 3
psuu01100  Metabolic pathways
psuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Psuf_020560
Enzymes [BR:psuu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     Psuf_020560
SSDB
Motif
Pfam: DeoC OMPdecase
Other DBs
NCBI-ProteinID: BCB84743
UniProt: A0A6F8YFD3
LinkDB
Position
complement(2354368..2355171)
AA seq 267 aa
MTVNNTLGGRIRLQHLYRHDPSSLFVVPLDHSVTDGPIARNGQLNRLIGQLAGNGVDAVV
LHKGALRHVDAGWFRSLSLIVHLSASTRHAPDPDAKYLVSSVEEALRLGAHAVSVHVNVG
SETEGRQIADLAAVAEAGDRWGVPLLAMLYPRGPQVADGRAPELVAHAATIAADLGADLV
KSALPTSATGIAAVAASCPVPVLAAGGAPSPGPDGALRHLADAMRAGAGGIAAGRLVFTA
PDPAATARRIAALVHDRTASTVLGGAR
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactgtcaataacacgctcggaggacgtatccggctgcagcatctgtaccggcacgac
ccgtcgagccttttcgtcgtgccgctcgaccattccgtgacggacggcccgatcgcccgg
aacggccagctcaaccgactgatcggtcagttggccggaaacggcgtcgacgccgtcgtc
ctgcacaagggggcgctgcggcacgtcgacgccggctggttccggtcgctctcgctgatc
gtccacttgagcgcgagcacccggcacgccccggaccccgacgccaagtacctcgtgtcc
tctgtggaggaggcgctgcggctcggcgcgcacgcggtgagcgtccacgtcaacgtcgga
tcggagacggaagggcggcagatcgccgacctggcggccgtcgccgaggcgggcgaccgc
tggggcgtacccctgctggcgatgctctatccgcgcggaccgcaggtcgccgacggccgc
gcgccggagctcgtggcgcacgcggccacgatcgcggccgacctcggcgcggacctggtc
aagtcggcgctgcccacctctgccaccgggatcgcggcggtcgccgcgagctgcccggtg
ccggtgctcgccgccggcggggcaccctcgcccggcccggacggcgccctgcgccacctc
gccgacgccatgcgggccggtgccggcggcatcgcggccggccgcctcgtcttcaccgcc
ccggatccggccgcgacggcacgccgcatcgccgcgctggtccacgaccgcacggcctcg
acggtcctgggcggggcccgatga

DBGET integrated database retrieval system