KEGG   Phytohabitans suffuscus: Psuf_091150
Entry
Psuf_091150       CDS       T06545                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
psuu  Phytohabitans suffuscus
Pathway
psuu00997  Biosynthesis of various secondary metabolites - part 3
psuu01100  Metabolic pathways
psuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psuu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Psuf_091150
Enzymes [BR:psuu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     Psuf_091150
SSDB
Motif
Pfam: DeoC TMP-TENI WGG NMO
Other DBs
NCBI-ProteinID: BCB91802
UniProt: A0A6F8Z0D2
LinkDB
Position
complement(9795777..9796601)
AA seq 274 aa
MVVLNASFARGLRLRRLFRHGDGRLVVVPLDHSVTDGPLGPGKLNSLLGELAGTGVDAVV
LHKGSLRHVDHGWFGDMSLIVHMSVSTRHAPDPDAKYLVAHVEEALRLGADAVSVHVNMG
SRQEARQIADLAAVAGECERWNVPLLAMVYARGPQITDSRAPELLAHAATLAADLGADVV
KVDYAGTPERMAEVVRACPIPVVVAGGPRSADTDAVLAYVSDALRGGAAGVAMGRNVFQA
DRPRWMAGAIARLVHESRHVPDQYDIDDRLALTS
NT seq 825 nt   +upstreamnt  +downstreamnt
gtggttgtactcaacgcctcgttcgcccggggcctgcgcctgcgacgcctgttccggcat
ggcgacgggcgcctggtcgtggtgccgctcgaccactccgtcaccgacggaccgctcggc
cccggcaagctgaactccctgctcggcgagctggccggcaccggcgtcgacgccgtggtg
ctgcacaagggcagcctgcgccacgtcgaccacggctggttcggcgacatgtcgctgatc
gtccacatgagcgtgagcacgaggcacgcgccggacccggacgcgaagtacctggtcgcc
cacgtggaggaggcgctgcggctgggcgccgacgcggtcagcgtgcacgtcaacatgggc
tcgcgccaggaggcccggcagatcgccgacctggcggccgtggcgggggagtgcgagcgc
tggaacgtcccgctgctcgccatggtgtacgcccgcggcccgcagatcaccgactcgcgg
gcgccggagctgctggcgcacgccgcgacgctcgctgccgacctcggcgcggacgtcgtc
aaggtcgactacgcgggtacccccgagcgcatggccgaggtggtccgcgcctgcccgatc
ccggtcgtcgtggccggcgggccccgcagcgccgacaccgacgccgtgctggcctacgtg
tccgacgcgctgcgcggcggtgccgccggggtggccatgggacgcaacgtcttccaggcc
gaccggccgcgctggatggccggcgcgatcgcgcggctggtgcacgagtcgcggcacgtg
cccgaccagtacgacatcgacgaccggctcgcccttacgtcctga

DBGET integrated database retrieval system