KEGG   Pseudoxanthomonas suwonensis J1: WQ53_00115Help
Entry
WQ53_00115        CDS       T04241                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Pathway
psuw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psuw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WQ53_00115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psuw02000]
    WQ53_00115
Enzymes [BR:psuw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WQ53_00115
Transporters [BR:psuw02000]
 Other Transporters
  Pores ion channels [TC:1]
   WQ53_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C DUF3791 PCP_red
Motif
Other DBs
NCBI-ProteinID: AKC85418
UniProt: A0A0E3YZD4
LinkDB All DBs
Position
complement(31437..32123)
Genome map
AA seq 228 aa AA seqDB search
MITVHHLENSRSQRVLWLLEELALPYQLVRYSRDPKTLLAPPALRAVHPLGKSPVLVDDG
HTLAESGAILDYLVERYDLAHTLSPTPLPVDSPERLQYRYWMHYAEGSAMPPLLLSLVLA
RIGAAPMPFFARPVARRIVEGAMAGFVGPQLRLHLDWMEGALARSGGWFGGERFTAADIQ
MSFPVEAAAVRGGLERYPQLADFLQRIHERPAYQRALAQGGPFALAGG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccaccacctggagaactcgcgctcgcagcgcgtgctgtggctgctggag
gaactggcgctgccgtaccagctggtgcgctattcgcgcgacccgaagaccctgctggcg
ccgccggcgctgcgcgcggtgcatccgctgggcaagtcgccggtgctggtcgacgacggc
cacaccctggccgagtcgggcgccatcctcgactatctggtcgagcgctacgacctcgcg
cacaccctgtcgccgacgccgctgccggtggattcgcccgagcggctgcagtaccgctac
tggatgcactacgccgagggctcggcgatgccgccgctgctgctgagcctggtgctggcg
cggatcggcgccgcgccgatgccgttcttcgcccggcctgtggcccgccgcatcgtcgag
ggggcgatggccggcttcgtcggcccgcagctcaggttgcacctggactggatggagggc
gcgctggcccgcagcggcggctggttcggcggcgagcgcttcaccgcggccgacatccag
atgagcttcccggtcgaggcggcggcggtgcgtggcggcctggagcggtacccgcagctg
gccgacttcctgcagcggatccacgagcggccggcctaccagcgggcgctggcgcagggc
gggccgttcgcgctggcgggtgggtga

DBGET integrated database retrieval system