KEGG   Pseudoxanthomonas suwonensis J1: WQ53_04030Help
Entry
WQ53_04030        CDS       T04241                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Brite
KEGG Orthology (KO) [BR:psuw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WQ53_04030
Enzymes [BR:psuw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WQ53_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin FAD_oxidored FAD_binding_3 AlaDh_PNT_C NAD_binding_7 DAO Thi4 K_oxygenase FMO-like NAD_binding_9 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKC86062
UniProt: A0A0E3Z0E7
LinkDB All DBs
Position
913333..914922
Genome map
AA seq 529 aa AA seqDB search
MLDDSLKTQLQAYLERLTRPVHLVASLDDGDASAQMLALLQDIEALSAKITLEARRDDAE
RKPSFAVTSPGHDISLRFAGLPMGHEFTSLVLALLQAGGHPSKAAAEVIEQVKSLDGEFV
FESYFSLSCQNCPDVVQALNLMAVLNPKVRHVAIDGALFQDEVEARQVMSVPTVFLNGRM
FGAGRMGLEEIVARLDSGAEKREAEKIARKAMFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTMAIENFISVPHTEGPKLAAALEQHVREYDVDVMNLQRATALVPAGADG
LVEIRLANGASLKSKTVVLSTGARWRQMGVPGENEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDAKLRADEVLQRKLRSLPNVRIVTSAQTTEVLGDG
HKVTGLVYTDRVGHDAHRLELEGVFVQIGLLPNTEWLKGTVELSPRGEIVVDDRGQTSVP
GVFAAGDCTTVPYKQIVIAMGEGSKAALAAFDHLIRASAPEAEPVAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacagcctcaagacccagctccaggcctacctggaacgcctgacccgcccg
gtgcacctggtcgcctcgctcgacgacggcgacgcctcggcgcagatgctcgccctgctg
caggacatcgaggccctgtcggcgaagatcaccctggaagcgcgccgcgacgatgccgag
cgcaagccgtcgttcgccgtgaccagccccggccacgacatctcgctgcgtttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggccctgctgcaggccggcgggcat
ccgtccaaggccgcagccgaggtgatcgagcaggtgaagtcgctcgacggcgagttcgtg
ttcgagagctacttctcgctgtcctgccagaactgcccggatgtggtccaggcgctgaac
ctgatggcggtgctcaacccgaaggtcaggcacgtggccatcgacggcgcgctgttccag
gacgaggtcgaggcacgccaggtgatgtcggtgccgaccgtgttcctcaacggccggatg
ttcggcgccgggcgcatgggcctggaggagatcgtggccaggctcgacagcggcgcggag
aagcgcgaggcggagaagatcgccaggaaggccatgttcgacgtgctggtggtcggcggc
ggcccggccggcgccgcggcggcggtctacgccgcgcgcaagggcatccgcaccggcgtg
gcggccgagcgcttcggcggccaggtgctggacacgatggcgatcgagaacttcatctcg
gtgccgcacaccgagggcccgaaactggccgcggcgctggagcagcacgtgcgcgaatac
gacgtggacgtgatgaacctgcagcgcgccaccgcgctggtgccggccggcgccgacggc
ctggtcgaaatcaggctggccaatggcgcctcgctgaagtcgaagaccgtggtcctgtcc
accggcgcgcgctggcggcagatgggcgtgcccggcgagaacgaataccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgggtggcggtgatc
ggcggcggcaactccggcgtggaggcggcgatcgacctggccggcatcgtcgcccacgtc
accctggtcgagttcgatgcgaagctgcgcgccgacgaggtcctgcagcgcaagctgcgc
agcctgccgaacgtgcgcatcgtcaccagcgcgcagaccaccgaagtgctgggcgacggg
cacaaggtcaccggcctggtctacaccgaccgcgtcggccacgacgcgcaccggctcgag
ctggaaggcgtgttcgtgcagatcggcctgctgcccaacaccgaatggctcaagggcacc
gtggaactgagcccgcgcggcgagatcgtggtcgacgaccgcggccagaccagcgtgccg
ggcgtgttcgccgccggcgactgcaccaccgtgccgtacaagcagatcgtgatcgcgatg
ggcgagggctccaaggccgcgctggccgcgttcgaccacctgatccgcgcttcggcgccg
gaagccgagccggtcgcggaagccgcctga

DBGET integrated database retrieval system