KEGG   Pseudoxanthomonas suwonensis J1: WQ53_05890Help
Entry
WQ53_05890        CDS       T04241                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Pathway
psuw00052  Galactose metabolism
psuw00511  Other glycan degradation
psuw00600  Sphingolipid metabolism
psuw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psuw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    WQ53_05890
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    WQ53_05890
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    WQ53_05890
Enzymes [BR:psuw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     WQ53_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Glyco_hydro_2_N Invasin_D3 BetaGal_dom4_5 DUF4232 Big_1
Motif
Other DBs
NCBI-ProteinID: AKC86372
UniProt: A0A0E3Z0Z4
LinkDB All DBs
Position
1387437..1390148
Genome map
AA seq 903 aa AA seqDB search
MALLLALPLLASALLVVPASAREQIRLDTGWRFHRGDPPGIDGRLDYDVRPEIVQSADGK
DADARPDEAVKTDAARPVLEPWILPTANAFIADPAQHHARPSGDPGSDVAFVQAAFDDSG
WEAVTLPHDWAIAGPFIAEGPYGGMGRLPSWGVGWYRRTLDIPAAMAARSVFLDVGGAMS
YATVWLNGRLVGGWPYGYNSWRVDLTPYLDFGGTNQLAIRLDNPPESARWYPGGGLYRDL
WLTIADPVHVGQWGTYVTTTDVSAKAATVNLRVDVDNAGDRKARVQVATDIFALDDAGAV
SGKPVARIAPQRLEVAAGSSARLQSSTRIERPRLWGPPPTQQPHRYLAVTTLARGGRTID
RYETRFGIRDVHWDPDRGVLVNGEHIPLRGVNQHHDLGALGAAFNLRAAERQLEILRGMG
VNAIRMAHNPPDPQLLELTDRMGFLVVDEVFDSWERKKTPLDFHRIFPEWHEADLRSMIR
RDRNHPSVILWSVGNEVGEQYDGEAGAALGRRLAAIAREEDPTRPTTASMNWAKADMPFP
AAFDVVNLNYQGEGIRQEAEFEGTERIRTPPSYPAFRAAFPDKVIIGSETASAFSSRGIY
LFPVSPLASAPVRDGRGGDSRIRHVSSYELHAVDFGSTADKVFATLDRHPYVAGEFVWNG
FDYLGEPTPYYDSRSSYSGIVDLAGFPKDRYFLYQSRWRPDLPMAHLLPHWTWPGREGQV
TPVHVFTSGDEAELFVNGVSQGRKRKGPYEYRLRWDEVVYQPGELHVQAYRDGRPWAGDT
VRTAGPPAKLELTVDRDRIAADGRDLAFATVRFLDGDGHPVPTATERIVFRVDGPGEVVA
TDNGDPTDLTPFPSHERNAFSGLALAIVRGVPGQAGTVTLHAGSGSLQGASVDITTLAVP
AAE
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcctggccctacccctccttgcctcggctctcctcgtcgtcccagcttcc
gcccgcgagcagatccgcctcgataccggctggcgcttccaccgcggcgacccgccgggc
atcgacggtcgcctggactatgacgtacgcccggagatcgtgcagagcgccgacggcaag
gacgccgatgcgcgtcccgacgaagcggtgaagaccgacgctgcgcgcccggtgctcgag
ccgtggatcctgcccaccgccaacgccttcatcgccgacccggcgcaacaccacgcgcgc
ccgtccggcgatccgggcagcgacgtggccttcgtccaggccgcgttcgacgacagcggc
tgggaggcggtcaccctgccgcacgactgggccatcgccggcccgttcatcgccgaaggc
ccctacggcggcatgggccgcctgccgagctggggcgtgggctggtaccggcgcacgctg
gatattcccgccgccatggccgcgcgctcggtgttcctggacgtcggcggcgcgatgtcc
tatgccacggtctggctcaatggccgcctggtcggcggctggccctacggctacaactcc
tggcgcgtggacctcacgccctacctcgacttcggcggaaccaaccagctcgccatccgc
ctggacaacccgcccgaatcggcgcgctggtatcccggcggcggcctgtaccgcgacctg
tggctgaccatcgccgacccggtccatgtcggccagtggggcacgtacgtcaccactacc
gatgtctcggccaaggccgcgacggtgaacctgcgcgtggacgtggacaacgccggcgac
cgcaaggcgcgggtgcaggtcgccaccgacatcttcgccctcgacgacgccggcgccgtg
tccggcaagcccgtcgcccgcatcgcgccgcagcggctcgaggtcgccgcgggttccagc
gcgcgcctgcagtcctccacccggatcgagcgtccgcgcctgtggggcccgccgccgacc
cagcagccgcaccgctacctcgccgtcaccaccctcgcgcgcggcggccgcaccatcgac
cgctacgagacccgtttcggcatccgcgacgtgcactgggacccggaccgcggcgtcctc
gtcaacggcgagcacatcccgctgcgcggggtgaaccagcaccacgacctcggcgcgctg
ggcgccgcgttcaacctccgcgcggccgaacgccagctggagatcctgcgcggcatgggc
gtcaacgcaatccggatggcgcacaacccacccgacccgcaactgctcgaactcaccgac
cgcatgggtttcctggtcgtggacgaggtgttcgactcctgggaaaggaagaagacgccg
ctggacttccatcggatcttcccggagtggcacgaggccgacctgcgttcgatgatccgc
cgcgaccgcaaccacccgtcggtgatcctgtggagcgtgggcaacgaggtcggcgagcag
tacgacggcgaggccggcgctgcgctcggccgccgcctggccgcgatcgcgcgcgaagag
gatccgacccgccccaccaccgcgtcgatgaactgggccaaggccgacatgcccttcccc
gccgccttcgacgtggtcaacctcaactaccagggcgagggcatccgccaggaggccgag
ttcgaaggcaccgagcggatccgcacgccgccgtcgtacccggcgttccgcgccgcgttc
ccggacaaggtgatcatcggcagcgagaccgcctcggccttcagcagccgcggcatctac
ctgttcccggtctcgccgctggccagcgcgccggtgcgcgacggccgcggcggcgattcg
aggatccgccatgtcagcagctacgagctgcacgcggtggacttcggctccaccgccgac
aaggtgttcgccaccctcgaccggcatccgtacgtggccggcgagttcgtctggaacggc
ttcgactacctgggcgaaccgaccccgtactacgactcgcgcagttcctacagcggcatc
gtcgacctcgccggcttccccaaggaccgctacttcctctaccagtcgcgctggcgcccg
gacctgccgatggcacacctgctgccgcactggacctggcccggccgcgagggccaggtc
acgccggtgcacgtgttcacctccggcgacgaggccgaactgttcgtcaacggcgtctcg
caggggcgcaagcggaagggaccgtacgagtaccggctgcgctgggacgaggtggtgtac
caaccgggcgaactgcacgtgcaggcgtaccgcgacggccggccctgggccggcgacacc
gtccgcaccgcgggtccgccggcgaagctcgagctgacggtcgaccgcgaccgcatcgcc
gccgacggccgcgacctggcgttcgccaccgtgcgcttcctcgacggcgacggccatccg
gtgccgaccgccaccgagcgcatcgtcttccgcgtcgatggccccggcgaggtcgtcgcc
accgacaatggcgatccgaccgacctgacgccgtttccttcgcacgagcgcaatgccttc
agtgggctggcgctggcgatcgtgcgtggcgtgcccgggcaggccggcacggtgacgctg
catgccggttccgggtcgctgcagggtgcgagtgtcgacatcaccacactggccgttccg
gcggcggagtaa

DBGET integrated database retrieval system