KEGG   Pseudoxanthomonas suwonensis J1: WQ53_09095Help
Entry
WQ53_09095        CDS       T04241                                 

Definition
(GenBank) dolichol-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Pathway
psuw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psuw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psuw01003]
    WQ53_09095
Enzymes [BR:psuw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     WQ53_09095
Glycosyltransferases [BR:psuw01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   WQ53_09095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: AKC86887
UniProt: A0A0E3Z1R7
LinkDB All DBs
Position
complement(2182397..2183119)
Genome map
AA seq 240 aa AA seqDB search
MTPPELSVVVPVFNERDNIPPLLEEIVAALRGRTSFEIVYVDDHSDDDSLAVLQALKVRV
PELRVLHHLSRSGQSTAVRNGIKAARGAWIATLDGDGQNDPADIPRLLAARDDAAPEVKL
FAGWRVDRRDSGSKRWASRWANRIRARILRDDTPDTGCGIKLLERAVFLDLPYFDHMHRY
LPALVQRAGWKTVSVPVAHRPRTAGVSKYNNLGRALVGLRDLRGVAWLIARSRRTRIEER
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacccgagctctccgtcgtcgtcccggtcttcaacgagcgcgacaacatcccg
ccgctgctcgaagagatcgtcgccgcgctgcgcggccgcacgtccttcgagatcgtctac
gtcgacgaccactcggacgacgactcgctggcggtgctgcaggcgttgaaggtccgggtg
ccggaactgcgcgtgctgcaccacctcagccgaagcgggcagagcaccgcggtgcgcaac
gggatcaaggccgcgcgcggcgcctggatcgccaccctcgacggtgacggccagaacgat
ccggccgacatcccgaggctgctggccgcgcgcgacgacgccgcgccggaggtcaaactg
ttcgccggctggcgggtggaccgccgggactccggctccaagcgctgggccagccgctgg
gccaaccggatccgcgcgcggatcctgcgcgacgacactcccgacaccggctgcgggatc
aagctgttggagcgcgcggtgttcctggacctgccctacttcgaccacatgcaccgctac
ctgccggcgctggtccagcgcgccggctggaagacagtcagcgtgccggtcgcgcaccgg
ccgcgcacggccggggtatccaagtacaacaacctgggccgcgccctggtcggcctgcgc
gacctgcgcggggtggcctggctgatcgcgcgcagccgccgcacccggatcgaggagcgc
tga

DBGET integrated database retrieval system