KEGG   Pseudoxanthomonas suwonensis J1: WQ53_12685Help
Entry
WQ53_12685        CDS       T04241                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Pathway
psuw00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:psuw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WQ53_12685
Enzymes [BR:psuw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     WQ53_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKC87483
UniProt: A0A0E3Z4K5
LinkDB All DBs
Position
3053439..3054875
Genome map
AA seq 478 aa AA seqDB search
MSRRFSSYIAGQWIEGEGGHADENPSDLATPVGEYGVVDAAHTAQAVEAAAAALPKWAFS
TPQQRADVLDFVGSEILARKEELGRLLAMEEGKTLPESIGEAARAGQIFKFFAGEALRIP
GEKLASTRPGVDVEITREPVGVVGIIAPWNFPLAIPAWKIAPALAYGNTVVFKPAEIVPG
CAWALADILSRAGLPEGVFNLVLGGGRTVGQALVAHPRLDALTFTGSAPTGHALLRQAAE
RALKVQMEMGGKNPLVVLADADLDKAVECAVNGAYFSTGQRCTASSRLIVENAVYDEFAA
RMQARLAKVRVGDPLEPGVDIGPVASGAQLDTDLAYIEAGHADGAELLAGGEQVEWKTPG
HFLAPTLFAAKPSDRIAREEIFGPVAALLRADDYEHALALANDTEFGLCAGICTNSLKHA
THFKRNAQAGMVMVNLPTAGVDPHVPFGGRKASSYGPREQGRYAVEFYTTVKTAYTSA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgacgtttcagcagctacatcgccgggcagtggatcgaaggcgagggcggccac
gccgacgagaacccgtccgacctggccacgccggtcggcgagtacggcgtggtcgacgcc
gcgcataccgcgcaggcggtcgaggcggcagcggcggccttgccgaagtgggcgttctcc
acgccgcagcagcgggccgacgtcctcgatttcgtcggcagcgagatcctggcgcgcaag
gaggaactgggccgcctgctggcgatggaagagggcaagaccctgccggagagcatcggc
gaagccgcccgcgccgggcagatcttcaagttcttcgccggcgaggcgttgcgcatcccc
ggcgagaagctggcgtcgacccgcccgggcgtggatgtggagatcacccgcgagccggtc
ggcgtggtcggcatcatcgcgccgtggaatttcccgctggcgatcccggcctggaagatc
gcgccggcgcttgcctacggcaacacggtggtgttcaagccggccgagatcgtgcccggc
tgtgcctgggcgctggccgatatcctctcccgcgccggcctgccggagggcgtgttcaac
cttgtgctcggcggcggccgcacggtcggccaggcgctggtcgcgcacccgcggctggac
gcgctgaccttcaccggctcggcgccgaccggccacgcgctgctgcgccaggcggcggag
cgcgcgctgaaggtgcagatggagatgggcggcaagaacccgctggtggtcctggccgac
gccgacctggacaaggcggtggagtgtgcggtcaacggcgcctacttctccaccggccag
cgctgcaccgcctcgagccggctgatcgtggagaacgcggtatacgacgagttcgcagcg
cgcatgcaggcgcggctggccaaggtcagggtcggcgatccgctggagccgggcgtcgac
atcggcccggtcgccagcggtgcgcaactggataccgatctggcctacatcgaggccggc
catgccgacggtgccgaactgctggccggcggcgaacaggtggaatggaagacgccgggc
cacttcctcgcgccgaccctgttcgcggccaagccctccgaccgcatcgcccgcgaggag
attttcggcccggtcgccgcgctgctgcgcgccgacgactacgagcacgcgctggcgctg
gccaatgacaccgagttcggcctgtgcgcgggcatctgcaccaactcgctgaaacatgcc
acgcacttcaagcggaacgcgcaggccggcatggtgatggtcaacctgcccaccgccggc
gtggatccgcacgtgccgttcggcggccgcaaggcttccagctacggcccgcgcgaacag
gggcgctacgcggtggagttctacacgacggtcaagacggcctatacctcggcctga

DBGET integrated database retrieval system