KEGG   Pseudomonas sp. VLB120: PVLB_04520Help
Entry
PVLB_04520        CDS       T02897                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00473  D-Alanine metabolism
psv00550  Peptidoglycan biosynthesis
psv01100  Metabolic pathways
psv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PVLB_04520 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PVLB_04520 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PVLB_04520 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psv01011]
    PVLB_04520 (ddl)
Enzymes [BR:psv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PVLB_04520 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:psv01011]
 Precursor biosynthesis
  Amino acid ligase
   PVLB_04520 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD ATPgrasp_Ter ATP-grasp_5 TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AGZ33711
LinkDB All DBs
Position
1028792..1029748
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALTTAGVDVVGIDVGDD
LLARLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCVAAGAELGFPLIVKPAHEGSSIGMAKVNSVQELVAAWKDAAK
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSA
KEKELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVVTRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagctgcattccaccctcgacgtcaaggcattcggtcgtgtc
gccgtgctgtacggcggcaagagcgccgagcgcgaggtgtcgctgaagtctggcgccgcc
gtgatcgatgcgctgaccactgccggtgtggacgtggtaggcatcgatgtgggtgatgac
ctgctggcccgcctgcagagcgagaagatcgaccgcgccttcatcattctccacggccgt
ggcggtgaagacggcagcatgcaaggcctgctcgagtgcctgggcatcccttacaccggt
agcgggatcctggcgtctgccctggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggcattccgaccccgcgccacgccgtgctggccagcgagagcgattgtgttgcc
gccggtgcggaactgggcttcccgttgatcgtcaaaccggcccatgaaggttcaagtatc
ggcatggcgaaggtgaacagcgtgcaagagctggtcgccgcctggaaggacgccgccaag
tacgattcgcaagttctggtcgagcaatggattcacggcccggagttcaccatcgcagtg
ttgcgcggccaggtgctgcctccgattgcgctgggcaccccgcacgtgttctacgactac
gacgccaagtacattgccaatgacacccagtaccgcattccgtgcggcctggacagtgcc
aaggaaaaggaactgatcgacctgaccgcgcgcgcctgcgatgccatcggcatcgaaggc
tgggggcggctggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcacccggcatgaccgaccatagcctggtgcccatggcggcgcgcgcggccggcctg
gacttccagcaactggtgctggcgatcctggctgaaagcgtcgtgacgcgaggttaa

DBGET integrated database retrieval system