KEGG   Pseudomonas sp. VLB120: PVLB_06745Help
Entry
PVLB_06745        CDS       T02897                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PVLB_06745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psv02000]
    PVLB_06745
Enzymes [BR:psv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PVLB_06745
Transporters [BR:psv02000]
 Other Transporters
  Pores ion channels [TC:1]
   PVLB_06745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_4 GST_N_5
Motif
Other DBs
NCBI-ProteinID: AGZ34152
LinkDB All DBs
Position
1525195..1525797
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYQSGNCYKIKLMLSLLDLPYEWHSVDILKGETQTPEFLAMNPNGKVPVLELED
GTCLWESNAILNYLADGTEFLPSEPRLRTQALQWQFFEQYSHEPYIAVARFIQFYLGLPD
ERVEEYRKLHKGGYKALKVMERQLQMTPYLVGDQYSIADVALYAYTHVAHQGGFDLADYP
AVRDWLARVASHPRHVPMSE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtttacggggattaccagtcgggtaactgctacaagatcaagctgatgctg
agcctgctcgacctgccgtatgaatggcactcggtggatatcctcaaaggagagacccaa
acgcccgaattcctggcgatgaaccccaacggcaaggtcccggtgctcgagctcgaggat
ggcacctgcctgtgggaatcgaacgccatcctcaactacctggccgatggcactgagttc
ctgcccagcgagccacgtttgcgtacccaggcgctgcaatggcagttcttcgagcagtac
agccatgagccgtacattgccgtggcgcgtttcatccagttttacctgggcctgccggat
gagcgtgtggaggagtaccgcaagctgcacaagggcggctacaaggcgctcaaggtgatg
gagcgccaattgcagatgacgccgtacctggtgggggatcaatattcgatcgccgatgtg
gcgctgtatgcctacacccacgtggcgcatcagggcggcttcgatctggccgattacccg
gcagtgcgtgactggttggccagggtggccagccatccgcgtcatgtgccgatgagcgag
tga

DBGET integrated database retrieval system