KEGG   Pseudomonas sp. VLB120: PVLB_06975Help
Entry
PVLB_06975        CDS       T02897                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00220  Arginine biosynthesis
psv00250  Alanine, aspartate and glutamate metabolism
psv00290  Valine, leucine and isoleucine biosynthesis
psv01100  Metabolic pathways
psv01110  Biosynthesis of secondary metabolites
psv01130  Biosynthesis of antibiotics
psv01210  2-Oxocarboxylic acid metabolism
psv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PVLB_06975
   00290 Valine, leucine and isoleucine biosynthesis
    PVLB_06975
   00220 Arginine biosynthesis
    PVLB_06975
Enzymes [BR:psv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PVLB_06975
    2.6.1.66  valine---pyruvate transaminase
     PVLB_06975
Amino acid related enzymes [BR:psv01007]
 Aminotransferase (transaminase)
  Class I
   PVLB_06975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: AGZ34198
LinkDB All DBs
Position
complement(1564572..1565783)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKQIEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSKELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKQHAQSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNAIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKGYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcgccgtttggcttcgaggcaccggacgaaatcctccaggatgtgatccgcaat
ctgcccaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcggtg
atgcagtactgccagcagaagcagatcgaaggcgtcggtatcgaggacatttacctcggc
aacggtgtgtccgagctgatcgtgatgtcgatgcaggccctgctcaacaacggcgacgaa
gtgctgatcccagcgcccgactacccgttgtggaccgctgcggtcagcctggccggcggc
aaaccggtccactacctgtgcgacgagcaggccgactggttcccggacctggaagacatc
aaggccaagatcacgccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggcgcggtgtactccaaggaactgctgctgggcatgctggaactggcgcgccagcacaac
ctggtggtgttctcggacgaaatctacgacaagatcctctacgacgaggccgtgcacatc
agcaccgcctcgctggccccggacttgctgtgcctgaccttcaacggcctgtccaaatcg
taccgggtcgctggcttccgctccggctggctgatcatctccgggcccaagcagcatgcc
cagagctacatcgaaggtatcgacatgctggccaacatgcgcctgtgcgccaacgtgccc
gcccagcatgccatccagaccgccctgggcggctaccaaagcatcaacgacctggtgctg
ccgccagggcgcctgctggagcagcgcaaccgcacctacgagttgctcaatgccatccca
ggcgtgagctgcgtcaagcccatgggcgcgctgtacgcgttcccgaagatcgacccgaaa
gtgtgcccaatccacaacgacgagaagttcgtgctcgacctgctgctgtcggaaaagcta
ctgatcgttcagggcaccgcgttcaactggccgtggccggaccacttccgcgtggtgacc
ttgccacgtgtggatgacctggagcaggcgattggccgcatcggtaatttcctgaagggg
tattcgcagtag

DBGET integrated database retrieval system