KEGG   Pseudomonas sp. VLB120: PVLB_09850Help
Entry
PVLB_09850        CDS       T02897                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00500  Starch and sucrose metabolism
psv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PVLB_09850
Enzymes [BR:psv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PVLB_09850
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PVLB_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGZ34766
LinkDB All DBs
Position
2156692..2160003
Genome map
AA seq 1103 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHVKSFFDANNDGIGDFPGLINKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGSMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKAVIGVMRFWLDMGVDGLRLDAIPYLIERDGTNNENLPETHQVLKAIRA
EIDANYPDRMLLAEANQWPEDTHPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSK
ADPQRLVLPPIMDPLYGYQTVNAEAQSHDPHSLLNWNRRLLAVRKQQKAFGRGTFKMLTP
SNRRILAYLREYTDANGNTEVILCVANVSRAAQAAELELSPYADMVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLTSHDRMPSWHIQPSEGLPELTTLVLRKRMEELLDAPCRDTLE
TAILPQYLPKRRWYAGKEGPLDQVQLSYGVRLATATTPVLLSEIEVRSEDTVTRYQLPFG
LLPEEQITTALPQQLALSRVRRGRQVGLITDAFVLEPFIRAVLRNCEAGTRLPCTAGELR
FERTDLLAAAGLSEESQVRYLGAEQSNSSVVVADRVVLKLIRRVNAGVHPELEMSAYLAA
AGFTNISPLLAWVSRVDEQGTPHLLMIAQGYLSNQGDAWAWTQNTLERAIRDQMEPSSNT
PDAHADALAELNGFAALLGQRLGEMHLLLARPSDDPAFTPRPSDARDSKRWSEQITAELA
RALDLLAQHRDSLDADSQALVDDLQQQRDGLAQHIDNLARQAQGGLLMRVHGDLHLGQVL
VVQGDAYLIDFEGEPARPLDERRAKHSPYKDVTGVLRSFDYAAAMILRSASAVDLSDAAR
QARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQQAEGERAALELFCLEKAAYEITYEAE
NRPSWLAVPLHGLHGLISTWGES
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgccctgctgccttcatcgacgacccactgtggtacaaggacgca
gtgatctaccagttgcacgtcaagtcgttcttcgacgccaacaacgatggcatcggcgat
tttcccggcctgatcaacaagctcgactacattgccgagctgggcgtcaacaccctctgg
ctgctgccattctacccgtccccccggcgcgacgacggttacgacatcgccgagtacaag
gccgtgcatcccgattacggcagcatggccgatgccaaacgcttcattgccgaggcgcac
aagcgtgggttgcgggtgattaccgagttggtcatcaaccacacctccgaccagcacccc
tggttccagcgagcccgccatgccaagcgcggcagcaaggcgcgggacttctacgtgtgg
tccgatgacgaccagaagtacgacggcacgcggatcatcttccttgacaccgaaaagtcc
aactggacctgggatccggtggccggccagtatttctggcaccgcttctactcccatcag
cccgacctcaacttcgataacccgcaggtgctcaaggcggtgatcggcgtcatgcgtttc
tggttggacatgggcgtcgatggcctacgtctggatgccattccgtacctgatcgagcgc
gatggcaccaacaacgagaacctccccgaaacccaccaggtactcaaggcgatccgcgcc
gagatcgacgccaactaccctgatcgcatgctgctggccgaggccaaccaatggccggag
gacacccacccgtacttcggcgaaggcgatggtgacgaatgccacatggcattccacttc
ccgttgatgccacgcatgtacatggccctggcgatggaggaccgttttccgatcaccgat
atcctgcgtcagacaccggagattccggccaactgccaatgggcgattttcctgcgcaac
cacgatgaactgaccctggagatggtcaccgaccgcgagcgcgactacctgtggaactac
tatgccgaggaccgccgcgcacgcatcaacctcggcatccgtcggcgcctggcgccgctg
ttgcagcgcgaccgtcggcgtatcgaactgctcaccagcctgctgctgtcgatgcccggc
acacccaccttgtattacggcgacgagctaggcatgggcgataacatctacctgggcgat
cgcgacggcgtgcgcacccccatgcaatggtcaccggaccgcaatggcggtttctccaag
gccgacccgcaacgcctggtgctaccgccgatcatggacccgctgtacggctaccagacc
gtcaacgccgaggcccagtcccacgacccgcactcgctgctcaattggaatcgccgcctg
ctggccgtccgcaaacaacagaaggcctttggtcgtggcaccttcaagatgctcacgccg
agtaaccggcggatcctggcctaccttcgcgaatacaccgacgcgaacggcaacactgaa
gtgatcctgtgcgtggccaacgtgtcgcgggctgcgcaggcggccgaactggagttgtcg
ccgtacgccgacatggtgccggtggagatgctcggcggcagcgcattcccgccgatcggc
cagttgccgttcttgctcaccttgcccccctatgcgttctactggttcttgctgacctcc
cacgaccgcatgcccagctggcacatccagccctccgaaggcctgccggagctcactacg
ctggtgttgcgcaagcgcatggaggagttgctcgacgcgccctgccgcgacaccctggaa
accgcgattctgccgcagtacctgcccaaacgccgctggtacgccggcaaggaagggcca
ctggaccaagtgcaactgagctatggcgtgcgcttggccacggccaccacgccggtgctg
ctgagcgagatcgaagttcgcagcgaagatactgtcacgcgttaccaactgccgttcggc
ctgttgcctgaagaacagatcaccaccgcgttgccccagcaactggcgctgtcccgcgta
cgccggggccgtcaggtgggactgatcaccgatgccttcgtgctcgaacccttcatccgc
gccgtgctgcgcaactgtgaggcaggcacgaggctgccctgcacggcgggcgagctacgt
ttcgaacgtaccgacttgcttgcggcagccgggctgtctgaggaaagccaggtacgctac
ctgggcgccgagcaatccaacagctcggtggtggtcgctgaccgcgtggtgctcaaactg
attcgtcgggtcaatgcaggcgtgcacccggaactggaaatgagcgcctacctcgcggct
gccgggttcaccaacatctccccgttgctggcctgggtcagccgggtggacgagcagggc
acaccgcacctgttgatgatcgcccaaggctacctgagcaaccagggcgatgcctgggcc
tggacccagaacaccctcgaacgggccatccgcgaccagatggagccttcgagcaacacc
cccgatgcccacgccgacgctctggccgaactaaacggtttcgcggccttgctcggccag
cggctgggcgagatgcacctgctgctggccaggcccagcgacgatcctgccttcacgcca
cggcccagcgatgcccgtgacagcaagcgttggagcgagcagatcacagccgaacttgcc
cgtgccctcgacctgctggcgcaacaccgcgacagcctcgatgccgacagccaggcgctg
gtcgatgacctgcagcagcaacgcgacggtctcgcccagcacatcgacaacctcgcgcgc
caggcccagggcggcttgctgatgcgcgtacacggcgacctgcacctgggtcaggtgctg
gtggtacagggcgatgcctacttgattgatttcgaaggagaacccgcccgtcctttggac
gagcggcgcgccaagcacagtccctacaaggatgtaaccggcgtgttgcgatccttcgac
tatgctgctgccatgatcctgcgcagcgcctcggcggtagacctctccgacgcggcgcgc
caggctcgtcagcgggttgcacggcagtacctgcaccagtcgcgccacgccttcgttgaa
gcctatggcctggccaccgccgcaatgccccacgcctggcaacaggctgagggcgagcgc
gccgccttggagctcttctgcctggaaaaagccgcctacgagatcacatacgaagccgaa
aaccgtccaagctggctggccgtgcctttgcatggcttgcatggactgatcagtacctgg
ggagagtcatag

DBGET integrated database retrieval system