KEGG   Pseudomonas sp. VLB120: PVLB_10720Help
Entry
PVLB_10720        CDS       T02897                                 

Definition
(GenBank) Ku family containing protein
  KO
K10979  DNA end-binding protein Ku
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PVLB_10720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psv03400]
    PVLB_10720
DNA repair and recombination proteins [BR:psv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PVLB_10720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ku Tom5
Motif
Other DBs
NCBI-ProteinID: AGZ34938
LinkDB All DBs
Position
2360741..2361583
Genome map
AA seq 280 aa AA seqDB search
MARAIWKGAISFGLVHIPVSLNTAVRTERVDFDWLDKRSMEPVGYKRVNKVTGKDIDKEN
IVKGVEYEKGRYVVISEEEIRAARPEATQTIDIFSFVDAGDIPLQHFDTPYYLSPDRRGG
KVYALLRETLESTGKVALATVVLHTRQHLALLRPLDDALVMITLRWPEEVRSIETLELDK
SVTEAKVDKRELDMAKRLVEDMSGPWSPDEYHDAFRQTILDLVEEKASKGKIETVEKGEG
TRTEKGADIIDLTELLKRSLGGGKTVKGKKSTTKRSRKAS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggccatctggaaaggcgcgatcagtttcggcttggtgcacatcccagtttcg
ctcaatacggcggtgcgtaccgagcgggtcgatttcgactggctcgacaagcgcagcatg
gagccggtgggctacaagcgggtgaacaaggtcactggcaaggacatcgacaaggaaaac
atcgtcaagggcgtggagtacgagaaaggtcgctatgtggtgatcagcgaggaagagatt
cgcgccgcgcggcctgaggcgacccaaaccatcgatatcttctccttcgtcgacgccggc
gacatcccgctgcagcactttgacaccccttactatctgagccccgaccgccgtggtggc
aaggtctacgcactgttgcgcgaaaccctggaaagcaccggcaaggtggcgttggcgacg
gtggtgctgcacacccgtcagcaccttgcgttgctgcggccgctggacgatgccctggtg
atgatcaccctgcgctggcccgaggaggtgcgcagcattgaaaccctggagttggacaag
agcgtgaccgaagccaaggtcgacaagcgcgaactggacatggccaagcggctggtcgag
gacatgagcgggccgtggtccccggatgagtaccacgatgcgtttcgccagaccattctt
gacctggtggaggaaaaggccagcaaaggcaagatcgagacggtggagaagggcgaaggt
acccgtacggagaaaggcgccgacatcatcgacctcaccgaactgctcaagcgcagcctg
ggcggcggcaagaccgtcaagggcaagaaatcgacgaccaaacgctcgcgcaaggcgtca
tga

DBGET integrated database retrieval system