KEGG   Pseudomonas sp. VLB120: PVLB_19630Help
Entry
PVLB_19630        CDS       T02897                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00620  Pyruvate metabolism
psv00680  Methane metabolism
psv01100  Metabolic pathways
psv01120  Microbial metabolism in diverse environments
psv01200  Carbon metabolism
Module
psv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PVLB_19630
  09102 Energy metabolism
   00680 Methane metabolism
    PVLB_19630
Enzymes [BR:psv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PVLB_19630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGZ36707
LinkDB All DBs
Position
complement(4317429..4320056)
Genome map
AA seq 875 aa AA seqDB search
MTDIDVRLREDVHLLGELLGETIRQQHGEAFLQKIEDIRHSAKADRRSAGEKLSSTLADL
ADEDLLPVARAFNQFLNLANMAEQYQLIRRRDADQPEPFESRVLPELLARLKQAGHSNDA
LARQLAKLDIQLVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLIPAERQQVRERLRRL
IAEAWHTEEIRRSRPTPVDEAKWGFAVIEHSLWQAIPNHLRKVDKALFEATGLHLPLEAA
PIRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLFLRDIDTLAAELSMQQASAALRE
QVGDSAEPYRALLKQLRDRLRATRAWAQASLASPQPMPAEVLVDNRDLIAPLELCYQSLH
ACGMGVIADGPLLDSLRRAVTFGLFLGRLDVRQDAARHRDALSEITDYLGLGSYAEWDED
RRIEFLQTELKNRRPLLPAHFKPQADTAEVLATCREVAAAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMERLLGLPGYRASLRGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICQEHQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPEPAWREVMDQLAADG
LKAYRGVVRENPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWETALTNALSRGQGPLLAQMREQWPFFRTRIDMLEMVLAKADAQIAEAYDER
LVQPHLLPLGAHLRDLLSQSCRVVLGLTGQPVLLAHSPETLEFISLRNTYLDPLHRLQAE
LLARSRSREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatcgatgtgcgcttgcgtgaagatgtccatctgttgggtgagctgcttggc
gagactattcgtcagcagcacggcgaagcgttcttgcagaagatcgaggacatccgccac
agcgccaaggccgatcgccgcagcgctggggagaagttgagctcgaccctggcggacttg
gccgacgaagacctgctgcctgtcgcccgagcgttcaaccagttcctcaacctggccaac
atggccgagcaatatcaactgattcgacgccgtgacgctgaccagccagagccgttcgag
tcgcgcgtattgccagaactgctggcgcgcctcaagcaggcagggcacagcaacgatgcg
ctggcccggcaactggccaagctggatatccaactggtgctcaccgctcacccgaccgag
gttgccaggcgtacgctgattcagaagtacgatgccatcgccgggcaattggccgcccag
gaccatcgggaccttatcccggctgagcgtcaacaggtacgcgagcgcttgcgcaggttg
atcgctgaggcctggcacaccgaagaaatacgccgcagccggcccacaccggtggatgaa
gccaaatggggcttcgcggtgatcgaacactccctgtggcaggccattcccaaccacttg
cgcaaagtcgataaagcgctgttcgaggccacgggcttgcacttgccactggaggcggcg
ccgatccgtttcgcgtcctggatgggcggcgaccgggatggcaaccccaacgtcacggcc
agcgttacccgggaagtcttgctactggctcgctggatggccgccgacctgttcctgcgc
gacatcgataccttggccgccgaactttccatgcagcaggccagcgctgcactgcgtgaa
caggtcggcgacagcgccgagccataccgggccttgctcaagcagttgcgcgaccgcctg
cgggcgacccgagcctgggcccaggcctcgctggccagcccgcagccgatgcctgccgaa
gtgctggtggacaaccgcgacctgatcgcaccgctggaactgtgctaccagtccctgcat
gcgtgcggcatgggtgtgatcgccgacggtccgctgctcgacagcctgcgtcgggcagtg
accttcggcctgttcctcggccgcctggacgtgcgccaggatgctgcccggcatcgcgat
gcgctgtcggaaatcaccgactacctgggtctgggcagttacgccgagtgggatgaagac
cggcggatcgagttcctccagaccgaactgaaaaaccgccggccgctgctgccggcgcat
ttcaagccccaggccgacaccgccgaggtattggccacgtgtcgggaagtcgcggcggcg
cccgcagcttccttgggttcctatgtcatctccatggcgggagccgcctcggatgtgctg
gccgtgcaattgctgctcaaggaagctggcctgacccgaccgatgcgtgtggtgccgctg
ttcgagaccctcgccgacctggataacgccggcccggtgatggagcggctgctgggcctg
ccgggctatcgcgccagcctgcgcggcccgcaggaagtgatgatcggctattccgactcg
gccaaggacgcgggcactaccgcagcggcctgggctcagtatcgcgctcaggagaacctg
gtgcgtatctgccaagagcatcaggtggaactgttgttgttccatggccgcggtggcacc
gtaggccgtggcggtggcccggcccacgcggcgattctgtcgcagccgccaggctcggtg
gcggggcggttccgcaccactgaacaaggcgagatgatccgtttcaagttcggtttgcca
ggcatcgccgagcagaacctcaacctttacctggccgccgtgctggaggccaccttgttg
ccgcctccgccccctgagccggcatggcgcgaggtgatggaccagttggcggccgatggc
ctcaaggcttatcgcggggtggtgcgagagaaccccgatttcgtcgaatatttccgtcag
tcgacgcccgagcaggagctggggcgcctgccgctgggcagtcgcccggccaagcgccgc
gccggcggtatagagagcttgcgcgccattccgtggatcttcggttggacccagacccgc
ctgatgctgcctgcctggctggggtgggagaccgcgctgaccaatgccttgagccgtggc
cagggcccgctgctggcgcagatgcgcgagcaatggccgttcttccgcacccgtatcgac
atgctggagatggtgttggccaaggccgacgcgcaaattgccgaggcctacgacgaacgt
ctagtgcaaccgcacctgcttcctttaggtgcgcacctgcgcgacctattgtcgcagtca
tgccgggtcgtactgggtttgaccgggcaaccggtgctactggcacacagccccgagacc
ctggaattcatcagcctgcgcaatacctacctggacccgctgcaccgccttcaggcggag
ttgctggcccgatcgcgcagccgtgaagccgctctggacagcccgttggagcaggccttg
ctagtgactgtggcgggtatcgccgcgggcttgcgcaacaccggttga

DBGET integrated database retrieval system