KEGG   Pseudomonas sp. VLB120: PVLB_20030Help
Entry
PVLB_20030        CDS       T02897                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
psv  Pseudomonas sp. VLB120
Brite
KEGG Orthology (KO) [BR:psv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PVLB_20030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DAP10 Gaa1
Motif
Other DBs
NCBI-ProteinID: AGZ36787
LinkDB All DBs
Position
complement(4406797..4407552)
Genome map
AA seq 251 aa AA seqDB search
MLTQLSLSPLDWLPILLAIGVAYIVFGIAGFGTALVAGPVLIHFMPLSRIIPLLVLLDFV
AAFGNLLPSRRDVVRGELLRLLPCMAVGCTLGVVFLLGLKSDLLLLLMGLFVTAYAIYGL
AVKVRPARLAGWWAVPMGTVGGLFGALFGSGGFLYAIYLSARLDAKEQVRATQSALISCS
TVVRLSLFLIAGVYADASLLLLAVSLLPVMFIGLWSGRRLTTKLSREAFVRLVTWLVLAS
GLALIGRYLSA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccagctgtcacttagccctctcgactggctacccattctcctcgccattggc
gttgcctacatcgtcttcggtatcgctggcttcggcacggcattggtggccggcccggtg
ctgatccacttcatgccgctgtcccgcatcatcccgctgttggtgttgctcgacttcgtc
gccgcattcggcaacctgctgccgtcacgccgtgatgtggtgcgcggtgagctgctgcgc
ctgctgccatgcatggcggtgggctgcacgttgggcgtggtgttcctgctggggctcaag
tccgacctgctgctgttactgatggggctgttcgtcaccgcctacgcgatctatggcctg
gctgtgaaggtgcgaccggccaggctggccggctggtgggcggtgccgatgggaacggtc
ggcggcctgttcggggcgttgttcggcagtggtggtttcctgtatgccatttacctgagc
gcacggctggacgcgaaagagcaggtcagggcaacccagagcgcgctgatcagttgcagc
acggtggtgcgcttgtcgctgttcctgatcgccggtgtctatgccgatgcgagcctgcta
ctgctggcagtctccctgctgccggtgatgttcataggcctgtggtccgggcgccggctg
accacgaagctgtcccgcgaagccttcgtgcgcctggtcacctggctggtcctggccagc
ggcctggccctgatcggtcgctacctgagtgcgtga

DBGET integrated database retrieval system