KEGG   Pseudomonas sp. VLB120: PVLB_25250Help
Entry
PVLB_25250        CDS       T02897                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00010  Glycolysis / Gluconeogenesis
psv01100  Metabolic pathways
psv01110  Biosynthesis of secondary metabolites
psv01120  Microbial metabolism in diverse environments
psv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVLB_25250
Enzymes [BR:psv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PVLB_25250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGZ37829
LinkDB All DBs
Position
5542578..5543474
Genome map
AA seq 298 aa AA seqDB search
MATFKVESEQHGELNCWRITSDRAELLIAQQGAQILSYQRVGEPPLLWLSDQAIFRKDKS
VRAGVPVCWPWFGNLQRNPQSVQAMYRGEQPPAHGLARTRDWQLLGIEEVGDGLRIEFEL
PEAKGELPGWPHEVELKLVVELDQDLTLTLTSCNQGTTPVTISQALHSYFALSDVRQARV
EGVEGLSYIETLADWEQRQQQGALGFTGETDRIYLNTPARLSIVDPHWNRRITLSSQGSR
SAVIWNPWTDRARELPDMADDGWQRMLCIETANVWDDVVELEPGASSSLQVRVGSDTI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaccttcaaggtcgaatccgagcaacatggcgaactcaactgctggcgcatcacc
agcgaccgcgccgaattactgatcgcccagcagggtgcgcagatcctcagctaccagcgc
gtgggcgagccaccgctgctgtggctgagcgaccaggccatcttccgaaaggacaagtcg
gtgcgcgcgggggtgccagtgtgctggccgtggttcggcaatctgcagcgcaacccccag
tcggtgcaggccatgtaccgtggcgagcagccgcctgcccatggtttggcgcgcacgcgt
gactggcaattgctgggtatcgaagaagttggcgatggcctgcgcatcgagttcgagctg
cccgaggcaaagggtgaactgcccggctggcctcatgaagtcgaactcaagcttgtggtg
gagctggaccaggacctgacgctgacgctgaccagctgtaatcagggcactaccccggtc
accatcagtcaggccctgcacagctactttgcgctcagcgatgtgcgacaggcgcgggtc
gaaggcgtcgaggggctgagctacatcgagaccctggcagactgggagcaacgccaacaa
cagggtgcactgggcttcaccggcgagaccgaccgcatctacctgaacacacccgctcga
ctgagcatcgtcgatccacactggaaccggcgcatcaccttgagcagccagggttcacgc
tcggcggtgatctggaacccatggaccgaccgcgcccgcgaactgccagacatggccgat
gatggctggcaacggatgctgtgcatcgagacggcgaacgtgtgggatgacgtagtggag
ttggaacctggggccagcagttcgctgcaggtccgggtgggtagtgacacgatctga

DBGET integrated database retrieval system