KEGG   Pseudomonas cremoricolorata: LK03_00630Help
Entry
LK03_00630        CDS       T03354                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
psw  Pseudomonas cremoricolorata
Pathway
psw03030  DNA replication
psw03410  Base excision repair
psw03420  Nucleotide excision repair
psw03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:psw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LK03_00630
   03410 Base excision repair
    LK03_00630
   03420 Nucleotide excision repair
    LK03_00630
   03430 Mismatch repair
    LK03_00630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psw03032]
    LK03_00630
   03400 DNA repair and recombination proteins [BR:psw03400]
    LK03_00630
Enzymes [BR:psw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LK03_00630
    6.5.1.6  DNA ligase (ATP or NAD+)
     LK03_00630
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LK03_00630
DNA replication proteins [BR:psw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LK03_00630
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LK03_00630
DNA repair and recombination proteins [BR:psw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LK03_00630
   NER (nucleotide excision repair)
    Other NER factors
     LK03_00630
   MMR (mismatch exicision repair)
    Other MMR factors
     LK03_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIR87826
UniProt: A0A089WGV1
LinkDB All DBs
Position
128392..130050
Genome map
AA seq 552 aa AA seqDB search
MKAFAELYLRLDATTSSNAKLLALREYFAVAPAHDAAWAVYFLAGGRPRQLVPTRVLREL
ATQLSGLPEWLFEESYQAVGDMAETISLLLPESEHATDEGLAHWVEHYLLPLRGQTPEAL
HERLPQLWAQLDRPSLMLCLKLITGSFRVGVSKLLVTRALAQLAELDPKRVAQRMVGYTD
LSHRPSAASYHKLIAAESEQEHQERGGQPYPFFLAHALQTPSEQFQALIGPPSDWQIEWK
WDGIRAQVVKRDGQLWIWSRGEELVTERFPELHSLVETLPDGVVLDGEILVWKPGSSAED
VAVQPFALLQQRLGRKTLGKKLLADAPVVLQAYDLLEWQGEDWRSRPQHERRAQLEQLTE
QHPLAPVLLSPLLQGPDWADLERQRQASRSLGVEGMMLKHREALYGVGRTKDMGVWWKWK
VDPFSVDAVLIYAQRGHGRRASLYSDYTFAVWDGPPGTAQRTLVPFAKAYSGLSDEEMRK
VDAIVRKTTVETFGPVRSVTPTLVFELGFEGIALSKRHKSGIAVRFPRMLRWRQDKTVEQ
ADDLAILQGLLG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgagctgtacctgcgcctggacgccaccacctcgagcaacgccaaa
ctgctcgccctgcgcgaatacttcgccgtcgcgccggcgcatgacgccgcttgggcggtg
tacttcctggccggtggacgcccgcggcaactggtgccgacccgggtgctgcgggaactg
gccacgcagttgtcgggcctgccggagtggctgttcgaagaaagctaccaggccgtgggc
gatatggccgaaaccatttccttgctgctgcccgagagcgaacatgccaccgacgagggc
ctggcccactgggtcgagcattacctgttgccgctacgtgggcaaactcccgaggccttg
cacgaacggctgccgcaactgtgggcgcagctcgatcgtccgagcctgatgctatgcctg
aagctgatcaccggcagctttcgcgtgggcgtctccaagctgctggtcacccgtgcgctg
gcgcagttggccgagctcgaccccaagcgcgtcgcgcaacgcatggtcggttataccgac
ctcagccaccgacccagcgccgccagttaccacaagctgatcgccgccgaatccgagcag
gaacatcaggagcgcggcggccagccgtacccattcttcctggcccatgccctgcaaaca
cccagtgagcaattccaggcgctgatcggcccgcccagcgattggcaaatcgagtggaag
tgggatggtatccgcgcccaggtggtcaagcgcgacggtcaactgtggatctggtcgcgt
ggcgaagaactggtcaccgaacgcttccccgaactgcacagcctggtcgaaaccctgccc
gatggtgtggtgctcgatggcgagattctggtgtggaagcccggcagcagcgctgaagac
gttgccgtacaacccttcgcgctgctgcagcaacgcttgggacgcaagacgctgggcaag
aagctgctggccgatgcgccggtggtactgcaggcctatgacctgctcgagtggcagggc
gaggactggcgcagccgcccccagcacgaacggcgtgcgcagctcgagcaactgaccgaa
cagcatccactggccccggtgttgctctcgcccctgttgcaaggcccggattgggccgac
ctcgaacgccagcgccaagcctcgcgcagcctgggggtcgagggcatgatgctcaaacac
cgcgaagcgctgtatggcgtgggtcggaccaaagacatgggcgtgtggtggaaatggaag
gtcgacccgttcagcgtcgatgccgtgctgatctatgctcagcgcggccatgggcgtcga
gcgagcctgtacagcgactacaccttcgccgtgtgggacggtccgccgggcacagcgcaa
cgcaccttggtaccgttcgccaaggcgtattcaggcttgagcgatgaagagatgcgcaag
gtcgatgctatcgtgcgcaagactaccgtggagacattcggcccggtgcgcagcgtcact
ccgacgctggtcttcgaactgggcttcgaaggcattgccttgtccaagcggcacaagagc
ggcatcgccgtacgcttcccgcgcatgctgcgctggcgccaggacaagaccgtcgagcaa
gccgacgatctggcaatcttgcagggtctgcttggctga

DBGET integrated database retrieval system