KEGG   Pseudomonas cremoricolorata: LK03_15665Help
Entry
LK03_15665        CDS       T03354                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psw  Pseudomonas cremoricolorata
Brite
KEGG Orthology (KO) [BR:psw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LK03_15665
Enzymes [BR:psw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LK03_15665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored AlaDh_PNT_C K_oxygenase Glutaredoxin FAD_binding_3 FMO-like Thi4 NAD_binding_9 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIR90621
UniProt: A0A089WPV8
LinkDB All DBs
Position
3359826..3361388
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLNTYLQRVSQPIEIVASLDDGAKSRELHDLLVEIASLSELITLRADGEDAR
RPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKASAELIEQIQGLDGEFVF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQAEVEARQIMAVPSVYLNGEPF
GQGRMGLDEIVNKLDTNAGSRQAQKLDAKQAFDMLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRSEALLPASDGGL
HQVRLASGATLRAKTVVLATGARWREMNVPGEQQYRNRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVILIEFDSQLRADAVLQRKLHSLGNVKVITSALTREVLGDGE
KVNGLRYQDRTSDTEHELALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGQTNIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaccctcaaatcgcaactcaacacttatctgcagcgagtcagccagccg
atcgagatcgttgcgtccctcgacgacggcgcaaaatcccgcgaacttcacgacctgctg
gtggaaatcgccagcttgtccgagctgatcacgctgcgcgccgacggtgaagatgcccgt
cgcccatcgttctcgctcaatcgccccggggctgacatcggcctgcgcttcgccggtatc
cccatgggccacgaattcacctccctggtgctggcgctactgcaagtgggcggccacccg
tcaaaggccagtgccgaactgatcgagcagattcaggggctggacggtgagttcgtcttc
gagacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaaccccaacgtgcgccatgtcgccatcgatggcgcgctgttccaggcc
gaggtcgaggcgcggcagatcatggcggtgccgagcgtctacctcaacggcgaaccgttc
ggtcagggccgcatgggcctggatgagatcgtcaacaaactcgacaccaatgccggtagc
cgtcaggcgcaaaagctcgatgccaagcaagcgttcgacatgctggtggttggcggtggt
cctgcaggcgctgccgcagcgatctacgcggcgcgcaagggcattcgtaccggcgttgcg
gccgaacgctttggcggtcaggtgctcgatactctggccatcgagaacttcatctcggtg
caggaaaccgaagggcccaagcttgccaccgcccttgaagagcatgtcaaacagtacgac
gtcgatatcatgaacctgcagcgcagcgaggccttgctgcccgccagcgacggcggcctg
caccaggtgcgcctggccagcggcgcgacgctgcgcgccaagactgtggtgctggcaacc
ggtgcgcgctggcgggaaatgaacgtgcctggcgagcagcagtatcgtaatcgcggtgtc
gcctactgcccgcactgcgatgggccgctgttcaagggcaagcgcgtggcggtgattggt
ggcggcaactcaggcgtcgaggcagccatcgatctggccggcatcgtggcccatgtgatc
ttgatcgagttcgacagccagttgcgcgccgatgcggtgttgcagcgcaagctgcacagc
ttgggcaacgtcaaagtcatcaccagtgcgctgacccgcgaagtgcttggcgatggcgag
aaggtcaacggcctgcgttatcaggaccgcaccagcgataccgagcacgagctggccctg
gaaggcatcttcgtgcagatcggactgctgcccaataccgattggctcaagggcacagtg
gagctgtcgccgcgcggtgagatcatcgtcgacgccaagggccagaccaacatccctggc
gtgttcgccgcgggcgatgtgaccaccgtgccttacaagcagatcgtcatcgccgtgggt
gagggcgccaaggcctcgctggctgccttcgatcacctgatccgcacctcggcaccggcc
tga

DBGET integrated database retrieval system