KEGG   Pseudomonas cremoricolorata: LK03_15770
Entry
LK03_15770        CDS       T03354                                 

Definition
(GenBank) type VI secretion system protein
  KO
K11892  type VI secretion system protein ImpK
Organism
psw  Pseudomonas cremoricolorata
Pathway
psw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LK03_15770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psw02044]
    LK03_15770
Secretion system [BR:psw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LK03_15770
SSDB
Motif
Pfam: DotU HIG_1_N
Other DBs
NCBI-ProteinID: AIR90639
UniProt: A0A089WU00
LinkDB
Position
complement(3384689..3385354)
AA seq 221 aa
MLDAALPLLGLVMRLRTLDSLPNISAVHQQVIGQINNIREEMRQQGYDPAQLVAYSYVQC
LHIDEAVMERPWGRSSCWSQRPLLSIFHDETWGGEKVFTVLSRLMQEPERFQDVLEFTYF
ALCLGLKGKYAIAPKGEETLNSLIHQLHGIIRERRGPTLQEVGAPYANVAPRNFRMHRRW
PWWSPLAICALVMALAYGLYSHRLNQITTEVLGSLNGILLQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgctggatgccgcattacccctgctagggctggtgatgcgcctgcgcaccctcgactct
ctgccgaacatcagcgccgtacaccagcaggtgatcgggcagatcaacaacatccgcgaa
gagatgcgccagcaaggctacgaccctgctcaactggtggcgtactcgtacgttcagtgc
ctgcacatcgatgaggccgtgatggagcgcccctggggcagaagcagctgttggagccag
agacctctgctgagcatctttcacgacgaaacttggggcggggagaaggtcttcacagtg
ctcagccgactgatgcaagagcctgagcgcttccaggacgtactggagttcacctacttc
gctttgtgtctgggcctgaagggcaagtacgccatcgccccgaagggtgaagaaaccctc
aacagcctgattcaccaactccacgggatcatccgcgagcgtcgcgggcctaccctgcaa
gaggtcggtgcgccctatgccaacgttgccccacgcaactttcgcatgcatcgacgatgg
ccttggtggagcccgttggctatctgcgcactggtcatggcactggcctacggcctctac
agccaccgtctgaaccagatcaccaccgaggtgctgggttcgctcaacggcatcttgctg
cagtaa

DBGET integrated database retrieval system