KEGG   Pseudomonas cremoricolorata: LK03_18305Help
Entry
LK03_18305        CDS       T03354                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psw  Pseudomonas cremoricolorata
Pathway
psw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LK03_18305 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psw03400]
    LK03_18305 (ligD)
Enzymes [BR:psw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LK03_18305 (ligD)
DNA repair and recombination proteins [BR:psw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LK03_18305 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AIR91099
UniProt: A0A089WV65
LinkDB All DBs
Position
3953249..3955711
Genome map
AA seq 820 aa AA seqDB search
MAKPLNEYQRKRDFSATPEPTGKRGRSGKAQALQFCIQKHDASHLHYDFRLELGGTLKSW
AVPKGPSLDPGQKRLAVHVEDHPLDYASFEGHIPEGHYGAGDVIVWDRGIWEPQGDALAG
YAKGKLQFRLHGEKLSGLWNLFRTRLAGKKEQWLLVKSDDEHARSEHDYSVVEALPDSVL
SERTLASSHPEPKRTQPAARARRKTDNATLPAILKPQLATLVEAAPSGDWRYEVKFDGYR
LLARIDGKDVRLFTRNGHDWSARLPRQIDALRALKLTSGWLDGEVVVADENGVADFQALQ
NAFDSNQADGLTYYLFDALWLNGDDLREQPLHARRAALQRLLESQPSDTLRYSEDFEGPV
DSLLASACELSLEGLIGKRADSPYRSRRSQDWIKLKCQRRQEFVIVGYTDPKGSREGFGA
LLLALHDDSGALRYAGRVGTGFSSQSLTQIHARLRRLHSSKPALQRPPTGAAARGVHWLR
PRLLAEVSYAQITRAGSVRHAVFHGLRDDKPAKAIDLERPAPSPSKHATLATVQLTHPER
VIDPSTGTTKQQVAEYYAAVAGWLLPHIEQRPVALVRAPEGLDGELFFQKHAAQLHLPDS
HSYSKQQAGQAAMTLDSSAALLTAVQMNTLELHSWNATGKSFERPDRFVLDLDPDPALPW
KAMLQATELTLTLLDTLGLTAFIKTSGGKGLHVIVPLTRRAGWDDVKHFSHAIVSHLAEL
FPERLTDVSGPKNRVGKIFIDYLRNGLGATTVCAYSLRARPGLAASVPVSREELPRLKGA
DQWTIATLLKRLDSVDDPWATMPATRQSITRRMRQQLGLA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccgttgaacgagtaccagcgcaagcgtgatttcagtgctacgccggaacct
acgggcaagcgcggtcggtccggcaaggcgcaagccctgcagttctgcattcaaaaacac
gatgccagccacctgcattacgattttcgtctggagctgggcggcacgctcaaaagctgg
gcggtacccaagggcccatcgctcgaccctgggcaaaagcgcctggccgtgcacgtcgaa
gaccacccgctggactatgccagcttcgaagggcatatcccggaaggccattatggtgcc
ggtgacgtgatcgtctgggatcgcggcatctgggaaccccaaggcgatgccctggcgggc
tacgccaaaggcaagctgcagtttcggctgcacggcgaaaagctctcaggcctgtggaat
ctgtttcgcacccgcctggccggcaagaaggagcaatggctactggtcaagtccgatgac
gagcatgcccgcagcgagcacgactacagcgtggtcgaagcacttccagacagcgtgctc
agcgagcgcaccctcgcctccagtcaccccgaacccaaacgcacccaacccgccgctcgc
gctcggcgcaagaccgacaacgccacccttcccgccatcctcaagccacaactggcgacg
ctggtggaagctgcacccagcggcgattggcgttatgaggtcaagttcgacggctaccgc
ctgctggcacgaatcgatggcaaggatgtgcggttgttcacccgtaacggccacgactgg
agcgccaggctgccgcgccagatcgacgccttgcgcgcactcaagctcacgtcggggtgg
ctcgacggtgaagtggtggtggccgatgaaaacggcgtggcggactttcaggccctgcag
aacgccttcgacagcaaccaggccgacggcctcacctactacctgttcgacgccctctgg
ctgaatggcgacgacctgcgtgagcaacccctgcacgctcgccgcgccgccttgcaacgg
ctgcttgagtcgcaacccagcgacaccttgcgctattccgaggacttcgaagggccggtc
gactcgctgctggccagcgcctgcgagctgtccctggaaggcttgatcggcaagcgggcg
gacagcccttaccgcagccgtcgcagtcaggactggatcaagctcaagtgccagcgccgg
caagagttcgtcatcgtcggctacaccgaccccaaaggcagtcgcgaaggtttcggcgcg
ctgctgctggcgctgcacgatgacagcggcgcgctgcgctacgccggccgggtcggcacc
ggtttcagcagccagagcctgacgcagattcatgctcgcctgcgacggctgcacagcagc
aagccggccttgcaacgaccgcctaccggggcagcagcacggggcgttcactggctgcgc
ccgcgattgctggccgaggtgtcgtacgcgcagatcacccgcgccggcagcgtccggcat
gcggtgtttcatggcctgcgcgacgataagccggccaaggccatcgacctcgaacgcccc
gctccgagcccatcgaaacacgccacgctcgccaccgtgcagctgactcaccccgagcgg
gtcatcgaccccagcacgggcactaccaagcaacaggttgccgagtactacgccgccgtg
gcgggttggctattgccgcacatcgagcagcgtccagtggccttggtgcgcgccccagag
ggcctcgacggcgagctgttcttccagaagcacgccgcccagctgcacctgccggatagt
cacagctacagcaagcaacaggcaggccaggcggcgatgactttggacagcagcgccgcg
ctgctgaccgcggtgcaaatgaacaccctggagttgcacagctggaacgccaccggcaag
tcgttcgagcggcccgatcgtttcgtgctcgacctcgatcccgacccggcgctgccgtgg
aaggcaatgctgcaggccaccgaactgaccctcacattgctcgataccctgggccttacg
gcgttcatcaagaccagcggtggtaagggcctgcacgtaatcgtgcccctgactcgccgc
gctggctgggatgacgtgaagcatttcagccacgccatcgtcagtcacctggccgagctg
ttccccgagcgcctgaccgatgtgtcggggccgaagaatcgcgtcggtaaaatcttcatc
gactacctgcgcaatgggctaggtgccaccacggtgtgcgcctactcactgcgcgcacgc
cccggtttggcagcgtcggtaccggtcagccgcgaagaactgccgcgcctcaagggcgcc
gaccaatggaccatcgccaccctgctcaagcgcctggacagcgtggacgatccgtgggcg
acgatgcccgctactcgccaatccatcacccggcgcatgcgccagcagctggggttggcg
taa

DBGET integrated database retrieval system